List of phages of the species vB_PaeM_C2-10_Ab1_genome currently in database:

			

LOCUS NC_019918 92777 bp DNA linear PHG
DEFINITION Pseudomonas phage vB_PaeM_C2-10_Ab1 complete genome.
ACCESSION NC_019918
VERSION NC_019918.1 GI:431809933
DBLINK Project: 184146 BioProject: PRJNA184146
KEYWORDS RefSeq; complete genome.
SOURCE Pseudomonas phage vB_PaeM_C2-10_Ab1
ORGANISM Pseudomonas phage vB_PaeM_C2-10_Ab1 Viruses; dsDNA viruses, no RNA
stage; Caudovirales; Myoviridae.
REFERENCE 1
AUTHORS Essoh,C., Blouin,Y., Loukou,G., Cablanmian,A., Lathro,S.,
Kutter,E., Thien,H.V., Vergnaud,G. and Pourcel,C.
TITLE The Susceptibility of Pseudomonas aeruginosa Strains from Cystic
Fibrosis Patients to Bacteriophages
JOURNAL PLoS ONE 8 (4), E60575 (2013)
PUBMED 23637754
REMARK Publication Status: Online-Only
REFERENCE 2 (bases 1 to 92777)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (19-DEC-2012) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 92777)
AUTHORS Vergnaud,G.
TITLE Direct Submission
JOURNAL Submitted (24-AUG-2012) DGA/MRIS, Mission Recherche et, Innovation
Scientifique, 7-9 rue des Mathurins, 92220 Bagneux, FRANCE
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. The reference sequence is identical to HE983845.
COMPLETENESS: full length.
FEATURES Location/Qualifiers
source 1..92777
/organism="Pseudomonas phage vB_PaeM_C2-10_Ab1"
/mol_type="genomic DNA"
/strain="vB_PaeM_C2-10_Ab1"
/host="Pseudomonas aeruginosa C2-10"
/db_xref="taxon:1231048"
/country="Cote d''Ivoire:Abidjan"
/collected_by="Christiane Essoh"
gene 332..925
/locus_tag="BN405_2-10_Ab1_orf_01"
/db_xref="GeneID:14296664"
CDS 332..925
/locus_tag="BN405_2-10_Ab1_orf_01"
/inference="similar to DNA
sequence:INSDC:HQ832595:PaP1_gp157"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236822.1"
/db_xref="GI:431809934 UniProtKB/TrEMBL:K4RM93
GeneID:14296664"
/translation="MTSNIHAKMHIHYAKQIYYAMRKRAIASDEICKEWAKPKTGFEAF
YDWVVNVSGYAVGYRLDRNILFPGNKLYAPHTCEFSPTYIHTLFTNCDKTSNNRANNDL
PLGVRLARFDRWRLPVYVSQCRTLGKQTTLGSFDDPMAAHVAWQHAKMESILECIDLYQ
MEDVHSVDVVQALLDRVDKLDKDIAQGRETILLQ"
gene complement(1438..1704)
/locus_tag="BN405_2-10_Ab1_orf_02"
/db_xref="GeneID:14296496"
CDS complement(1438..1704)
/locus_tag="BN405_2-10_Ab1_orf_02"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_004"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236823.1"
/db_xref="GI:431809935 UniProtKB/TrEMBL:K4RL83
GeneID:14296496"
/translation="MLRLEGLMSEQYWYPARIGCIKSLKAVAWEAWSRDFWDDENLNKI
LRHNGFSPDQSKERALQYMDQINEEYCKVMQGCLEAEDMEYNQ"
gene complement(1676..2107)
/locus_tag="BN405_2-10_Ab1_orf_03"
/db_xref="GeneID:14296497"
CDS complement(1676..2107)
/locus_tag="BN405_2-10_Ab1_orf_03"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_005"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236824.1"
/db_xref="GI:431809936 UniProtKB/TrEMBL:K4RI17
GeneID:14296497"
/translation="MQTWRKRMKTKEIDVSNFTAEQFDAFLEYCQYAQLKVGEGVVDKI
REWMEHPISVDGPDDSPRCLYIRDHPEDRFISYGTGLRSKWQPDVYDLYRPTFQTKCVM
TLGKADKYVVVGDETISLEELKTILAKQGVFAAFGGSNV"
gene complement(2076..2498)
/locus_tag="BN405_2-10_Ab1_orf_04"
/db_xref="GeneID:14296498"
CDS complement(2076..2498)
/locus_tag="BN405_2-10_Ab1_orf_04"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_006"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236825.1"
/db_xref="GI:431809937 UniProtKB/TrEMBL:K4RM15
GeneID:14296498"
/translation="MKLKERLVKFYTIVKTPEENIAVQQHLKAYGIEFGSGNGFMYDKA
QVLLWVGDNLLDYTRKSDGSPMTFLWYEEELKGAIGYSKSTYDFRRVDFHFVTEKKVTA
YTLHECDTGPTTELNGTYTLQALKEIIADMEEENEN"
gene complement(2515..3228)
/locus_tag="BN405_2-10_Ab1_orf_05"
/db_xref="GeneID:14296499"
CDS complement(2515..3228)
/locus_tag="BN405_2-10_Ab1_orf_05"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_007"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236826.1"
/db_xref="GI:431809938 UniProtKB/TrEMBL:K4RKT3
GeneID:14296499"
/translation="MNMFKKLFAWFREEESNDEPKVLESRAEEFQVEECYDPASRPVKY
INAKQIKRLKELDAKVGDPVKAICATFFDWKRWIVDRNWRFSMMAHRIDEKVHITDSKT
GTVLQWRATADSDLRPVGFLWRDIPLVRDAADLVLTNMPWMTSEEKEYAALMARKAIAA
LADKKDYIDKLVARKRSRDNYKAGLIDRALMMEKYVGVQEGDEWDIILKEARERLERSI
PTESLTMDWERFTLP"
gene complement(3225..3503)
/locus_tag="BN405_2-10_Ab1_orf_06"
/db_xref="GeneID:14296500"
CDS complement(3225..3503)
/locus_tag="BN405_2-10_Ab1_orf_06"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_008"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236827.1"
/db_xref="GI:431809939 UniProtKB/TrEMBL:K4RM96
GeneID:14296500"
/translation="MEQVGLLILVCIIVGVVCLLFYSVIGMFVWESLRPLLGWRGESTE
RRKKEARAVLAGIFWPIAVPFMAMLFLVSLPRKVWRLTRVAITGEED"
gene complement(3491..3802)
/locus_tag="BN405_2-10_Ab1_orf_07"
/db_xref="GeneID:14296501"
CDS complement(3491..3802)
/locus_tag="BN405_2-10_Ab1_orf_07"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236828.1"
/db_xref="GI:431809940 UniProtKB/TrEMBL:K4RL86
GeneID:14296501"
/translation="MEIIPALFILSLAWGIAFMWTYMGIKEYFENNFLTRETKDHRDGI
EAFAIVLGLLWPITFTVYASFILIYASYSVLRVVLLPKWVLSIWRSRKLLKRIAPWNK"
gene complement(3802..4164)
/locus_tag="BN405_2-10_Ab1_orf_08"
/db_xref="GeneID:14296502"
CDS complement(3802..4164)
/locus_tag="BN405_2-10_Ab1_orf_08"
/inference="similar to DNA
sequence:INSDC:HQ832595:PaP1_gp008"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236829.1"
/db_xref="GI:431809941 UniProtKB/TrEMBL:K4RI18
GeneID:14296502"
/translation="MNSNSIAPLIKEGMRAFLENEEEPYMCYILERLALCSDSSVTVSD
VGRFKGWLDKTFGIGPLNSVMRLLDEVADSCVLSMFENNPPNKDWEDYWEGWAIGRAWC
NFYVWAYFDLIRKGGE"
gene complement(4154..4447)
/locus_tag="BN405_2-10_Ab1_orf_09"
/db_xref="GeneID:14296503"
CDS complement(4154..4447)
/locus_tag="BN405_2-10_Ab1_orf_09"
/inference="similar to DNA
sequence:INSDC:HQ832595:PaP1_gp009"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236830.1"
/db_xref="GI:431809942 UniProtKB/TrEMBL:K4RM16
GeneID:14296503"
/translation="MRSVAELIKIGLEDYLVNGRDTYMCYILSDLTEEGQITLEEYRLF
RIWLIEEHGIPSWESVTSYLHRNCMKGTDLNWVNFYVWSYFDLIRKEENNEL"
gene complement(4503..4691)
/locus_tag="BN405_2-10_Ab1_orf_10"
/db_xref="GeneID:14296504"
CDS complement(4503..4691)
/locus_tag="BN405_2-10_Ab1_orf_10"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp008"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236831.1"
/db_xref="GI:431809943 UniProtKB/TrEMBL:K4RKT7
GeneID:14296504"
/translation="MDTFKDGTEEYVLFRRGDNGFITYFGSFATKYAAIDYAFLLEYNR
YPSAYEEADLYNWVVMC"
gene complement(4715..5089)
/locus_tag="BN405_2-10_Ab1_orf_11"
/db_xref="GeneID:14296505"
CDS complement(4715..5089)
/locus_tag="BN405_2-10_Ab1_orf_11"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_011"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236832.1"
/db_xref="GI:431809944 UniProtKB/TrEMBL:K4RM98
GeneID:14296505"
/translation="MFPRQTKRRVSMFKKLVAIAFTLALHSCGVAPAYAEDTSGRDAEY
CSAVVAHLTSMPMEAMLSALDVRPGDDPVIRVANTMYIYTCKVEGNLVLVKGDFEKGFY
RAFLVQEDEYNYYISREEML"
gene complement(5058..5561)
/locus_tag="BN405_2-10_Ab1_orf_12"
/db_xref="GeneID:14296516"
CDS complement(5058..5561)
/locus_tag="BN405_2-10_Ab1_orf_12"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_012"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236833.1"
/db_xref="GI:431809945 UniProtKB/TrEMBL:K4RL89
GeneID:14296516"
/translation="MLTCEEIEELKSRIGANADRLIHKVERGLVPPLDTSRGRKPSFFF
NAVQPEMYEVMVELDGDYPLWVDDVLQGVARLDWYRPDERSIPLSAKKLLTIFASLSNI
NAHTISHLLRVEARQANRYYKAAEFAHEKLIDGFCKDELRCMKYPETFVYPKPDVPQTD
QEEG"
gene complement(5548..5979)
/locus_tag="BN405_2-10_Ab1_orf_13"
/db_xref="GeneID:14296527"
CDS complement(5548..5979)
/locus_tag="BN405_2-10_Ab1_orf_13"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp011"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236834.1"
/db_xref="GI:431809946 UniProtKB/TrEMBL:K4RI19
GeneID:14296527"
/translation="MQIETESWRSCKTNRGTVMYTVEVPEVPVVCDITDPNRRCMQWIR
ARIIRLKNNQSTGFEDIYVLEPSHVDLECRWREENDPEEHVRWAIAWFDVDMCDGQKFR
QLIRYDINNMFKWYGPANLTCEGVFTIEKSKVCPPYVDM"
gene complement(5945..6652)
/locus_tag="BN405_2-10_Ab1_orf_14"
/db_xref="GeneID:14296538"
CDS complement(5945..6652)
/locus_tag="BN405_2-10_Ab1_orf_14"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_014"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236835.1"
/db_xref="GI:431809947 UniProtKB/TrEMBL:K4RM18
GeneID:14296538"
/translation="MQGGKHRPRRQLLSGVSGVHQPRRGLSSPLDYIRRTGTNGETMRY
YTGVGSRDTPNREWGILREVGRKLAEQGFILRSGGAKGADSAFEAGWLDYISNNKGGTT
AEIYLPSPGFNQYQITETLGATILPEEELPAEWEEAKGIASQIHPAWNSVRNDGRSVLS
PFARRAHTRNVFQVLGIDLNTPSKFLVCWSKTDHNGIPEGGTRTAWQLASSRGVPCFNL
YRHADRDRIMAFL"
gene complement(6997..7476)
/locus_tag="BN405_2-10_Ab1_orf_15"
/db_xref="GeneID:14296549"
CDS complement(6997..7476)
/locus_tag="BN405_2-10_Ab1_orf_15"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp015; similar to
Aeromonas phage 25 hypothetical protein PHG25ORF093c
(YP_656328),Pseudomonas phage phiKZ ORF104 (NP_803670) and
Bacillus pumilus SAFR-032 hypothetical protein
(YP_001486895)"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236836.1"
/db_xref="GI:431809948 InterPro:IPR002589
UniProtKB/TrEMBL:K4RKU1 GeneID:14296549"
/translation="MIKYRKGDLIAAFKNKELHAIAHQANCFNTMGSGIAKQIREQFPE
AYEADLATEKGDRAKLGSLTFTMNEYGSIYNLYGQYNYGREEGRVYTQLDALGQALYTM
SLFLEAEADARAIPTSELCVGLPKIGCGLAGEDWSNVEPLIEETLGQFQVYVYEL"
gene complement(7473..7724)
/locus_tag="BN405_2-10_Ab1_orf_16"
/db_xref="GeneID:14296560"
CDS complement(7473..7724)
/locus_tag="BN405_2-10_Ab1_orf_16"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_017"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236837.1"
/db_xref="GI:431809949 UniProtKB/TrEMBL:K4RMA0
GeneID:14296560"
/translation="MIWNPSVIGLRTACKEARMLAKYYFTTFCEQGRPENKGHRLFKFK
IWEKGYWSPFAALDLMYDKIRADAEGLNIRYTSVERFK"
gene complement(7681..9402)
/locus_tag="BN405_2-10_Ab1_orf_17"
/db_xref="GeneID:14296569"
CDS complement(7681..9402)
/locus_tag="BN405_2-10_Ab1_orf_17"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp017; similar to
Staphylococcus phage K nicotinamide phosphoribosyl
transferase (YP_024539) and Cronobacter sakazakii ATCC
BAA-894 putative nicotinate phosphoribosyltransferase
(YP_001440399)"
/codon_start=1
/transl_table=11
/product="putative nicotinamide phosphoribosyl transferase"
/protein_id="YP_007236838.1"
/db_xref="GI:431809950 GOA:K4RL94 InterPro:IPR002638
InterPro:IPR015977 InterPro:IPR016471
UniProtKB/TrEMBL:K4RL94 GeneID:14296569"
/translation="MGPFNTTGGNNMKILPHLSTDGYKIGHGSMYSEGTQLVYSNLTPR
SDKIYRKTHATDFYDGTLKWVGGRAAWMEIVESWEGFFKADEENAVGRYARFLTGYFGR
EMEAVEQLRALHKLGYLPLEVKSLTEGVSVPMGVPVLTIKNTLPEFYWLXNYHETLISA
MTWKTATNATIAAEYAAMGRYYANHTGCYDDFLLSVQFHDFSARGMSGIEDAARSGVGH
LTSFVGSDTLAAAIYAEDYYNATGLVACSVPATEHAVATSNILRIEKEMKDGEGKGGRE
EAERRFLVDLMGKFPSGILSYVADSFDFWGVLTDILPSIKDQIMERDGKLVVRPDSGDP
VEVICGLGDVEVVESLEHWDIMDAVNGNDAFVLEFEDKYFKVIPTEWDQYEYVVGYKLE
EVSEAQVKGAIQVLWETFGGTVNEAGYKMLDSHIGLIYGDSITTRRAAKILERLKEKGF
ASLNVVFGVGSYTYQCNTRDTFGFAVKATYTEVNGEGIAIFKDPKTDSKKKSAKGLLKV
YRDQDNGRFLRLKDDVSKEEEATGHLRTFFKDGKWDTEDLKNNDLESIRYRIKNGV"
gene complement(9426..9644)
/locus_tag="BN405_2-10_Ab1_orf_18"
/db_xref="GeneID:14296570"
CDS complement(9426..9644)
/locus_tag="BN405_2-10_Ab1_orf_18"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp018"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236839.1"
/db_xref="GI:431809951 UniProtKB/TrEMBL:K4RI20
GeneID:14296570"
/translation="MSLSIWIVEYKRSSPEKRVVKVEEFDTKEELDARYKVLHEKFWED
FHSKKQPLLRLPCVYPVLTLPVEEIEY"
gene complement(9641..10516)
/locus_tag="BN405_2-10_Ab1_orf_19"
/db_xref="GeneID:14296571"
CDS complement(9641..10516)
/locus_tag="BN405_2-10_Ab1_orf_19"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp019; similar to
Enterobacteria phage Felix 01 putative ribose-phosphate
pyrophosphokinase (NP_945016) and Chromobacterium violaceum
ATCC 12472 ribose-phosphate diphosphokinase (NP_899703)"
/codon_start=1
/transl_table=11
/product="putative ribose-phosphate pyrophosphokinase"
/protein_id="YP_007236840.1"
/db_xref="GI:431809952 GOA:K4RM20 UniProtKB/TrEMBL:K4RM20
GeneID:14296571"
/translation="MISYVTGYLATIEEPGFALPMKEAKVWTFPGGEVGVNVSGIDASG
GSFVNVKAQIQNSDDIMALLNVTEAIRAAMGRPHMTLLLGYVPYARQDRRCNPGDAFSL
KVFANLINSAGYDRVIVVDPHSEATLHLINNVEVVSQSSVFGGLLNRSDWEQYQIVAPD
IGATKRTEQFAKETGARVIIRCNKKRDLQTGKIEGFEILNPSDINPELPLLVLDDICDG
GATFRSVAKALRGYSEVLPDLFVTHGIFSKGVDCLLDDFGCIYTSDTLPQENHPELMVV
PVEYSRAEKL"
gene complement(10526..10942)
/locus_tag="BN405_2-10_Ab1_orf_20"
/db_xref="GeneID:14296572"
CDS complement(10526..10942)
/locus_tag="BN405_2-10_Ab1_orf_20"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_021"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236841.1"
/db_xref="GI:431809953 UniProtKB/TrEMBL:K4RKU4
GeneID:14296572"
/translation="MKEKILYIIRGLPGSGKSSFAENLYNKTWKSGGLASICEADDYQM
EFGKYVWKAERVAESHKKCMAKARSSMEVGLEAVIVSNTSTREREIKPYIDMAEEFGYT
VISLIVENRHGNKSVHDVPESTMEAMRNRFSVKL"
gene complement(10953..11906)
/locus_tag="BN405_2-10_Ab1_orf_21"
/db_xref="GeneID:14296573"
CDS complement(10953..11906)
/locus_tag="BN405_2-10_Ab1_orf_21"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_022"
/codon_start=1
/transl_table=11
/product="putative RNA ligase/tail attachment protein"
/protein_id="YP_007236842.1"
/db_xref="GI:431809954 GOA:K4RMA2 InterPro:IPR019039
UniProtKB/TrEMBL:K4RMA2 GeneID:14296573"
/translation="MPNCRIEIRRSRMEGNLNIAMYKDLIANKLVTVKHFNGMSIIKYA
RKVFYENLWNEHPLLLEARGHVFDQHSGDCIVRPFEKVFNLGENGAGSFLHPKFRVRLI
EKVNGFMFSVTKHNGSLIFSTTGSLTSDYVALGQKYVSNNPDDYIAGFTYNFEICSPDD
PHIVEEEEGAYLIGIRDIFTGGQLSEYILDSHALGVTDHSSVKILRPEHIECSWEHAKG
LLSSCEKEGYMVQTGLGTVKCKSTHYLGKKFIMRMGSKKVNSMYQDPAGFKQTLDEEFY
PLVDFLVNEVEEVRFTEMTDAQRRLLIETYFDMARI"
gene complement(11882..12289)
/locus_tag="BN405_2-10_Ab1_orf_22"
/db_xref="GeneID:14296574"
CDS complement(11882..12289)
/locus_tag="BN405_2-10_Ab1_orf_22"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_023"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236843.1"
/db_xref="GI:431809955 UniProtKB/TrEMBL:K4RL98
GeneID:14296574"
/translation="MKIDKNSWHMRLHRTFETPVYSAISSGWQIVTLCSYFWQTVFLVV
WLALTVVALAAVVGSVLYSLALGPLTGYVLGGTLAVMGFVWIGIIAVFYGVWVFYRFSR
FMSSKSSSKDGILVSYLKAKKAKFCPIVELK"
gene complement(12286..12561)
/locus_tag="BN405_2-10_Ab1_orf_23"
/db_xref="GeneID:14296575"
CDS complement(12286..12561)
/locus_tag="BN405_2-10_Ab1_orf_23"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_024"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236844.1"
/db_xref="GI:431809956 GOA:K4RI21 InterPro:IPR010982
UniProtKB/TrEMBL:K4RI21 GeneID:14296575"
/translation="MNDPVKDFKKTVMVVAAHYITQSGLTQREVAERCGTHQSRISNLM
KQHVDKFSIESILEIVHKLGGYKMVASMELEEHNVLNFNIFPEEQA"
gene complement(12812..13366)
/locus_tag="BN405_2-10_Ab1_orf_24"
/db_xref="GeneID:14296576"
CDS complement(12812..13366)
/locus_tag="BN405_2-10_Ab1_orf_24"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_026"
/codon_start=1
/transl_table=11
/product="putative phosphoesterase"
/protein_id="YP_007236845.1"
/db_xref="GI:431809957 InterPro:IPR024654
UniProtKB/TrEMBL:K4RM22 GeneID:14296576"
/translation="MSVFFSSDLHFFHKNVIEYCNRPWTFEEQTEELISRWNSRVRLRD
EVYHLGDFAFAGKNKLQAVLDIIRQLNGRITFLKGNHCDSRLWKLIEDSNLSHVEDIRD
YKEVRIDGVKIVMCHYPFETWNTAHHGAWHLHGHTHGSLPSKGKRLDVGIDNHPDHQVF
SYDEVREYMREQEFVVVDHHK"
gene complement(13366..13707)
/locus_tag="BN405_2-10_Ab1_orf_25"
/db_xref="GeneID:14296577"
CDS complement(13366..13707)
/locus_tag="BN405_2-10_Ab1_orf_25"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_027"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236846.1"
/db_xref="GI:431809958 UniProtKB/TrEMBL:K4RKU8
GeneID:14296577"
/translation="MQAESAVEEAIISYSRPYSFFEKLRGVDKWSPKELLKKDAVDHWL
GVEGHLYREGKISADHYWVVDFHYEHRDMLSEFKAMASMEPEREHLLGGAAMRLIRRIN
KIYEFEMEA"
gene complement(13787..14347)
/locus_tag="BN405_2-10_Ab1_orf_26"
/db_xref="GeneID:14296578"
CDS complement(13787..14347)
/locus_tag="BN405_2-10_Ab1_orf_26"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_028"
/codon_start=1
/transl_table=11
/product="putative phosphohydrolase"
/protein_id="YP_007236847.1"
/db_xref="GI:431809959 GOA:K4RMA5 InterPro:IPR003607
UniProtKB/TrEMBL:K4RMA5 GeneID:14296578"
/translation="MNTQLGIAIEIALSAHEGQRYGETNFPYAYHLNQVHTVCVARNAP
KDMDPGQAFSDLPYMDTLLAVCFLHDVLEDTELTEEDLESMGVMPHIVEALVILDKNRA
ESYRKYIEACRNHPVAREVKICDTIANLTNSVMSGNSKRIKKYSNQLSMLEREASVLEN
KARKKTTRSDKFKGYVGEQYSVE"
gene complement(14349..14909)
/locus_tag="BN405_2-10_Ab1_orf_27"
/db_xref="GeneID:14296579"
CDS complement(14349..14909)
/locus_tag="BN405_2-10_Ab1_orf_27"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_029"
/codon_start=1
/transl_table=11
/product="putative cell wall hydrolase"
/protein_id="YP_007236848.1"
/db_xref="GI:431809960 GOA:K4RLA2 InterPro:IPR011105
UniProtKB/TrEMBL:K4RLA2 GeneID:14296579"
/translation="METLEALVLSILLAFIGMFLDMEYSRLKYGTEPVVEFQASPGQII
ESKRTLCEYRKPCRLLAEAVYFEARGEPEIGQIAVAHTVVNRMKHDRWPSTVAGVLYFK
CQYSYTCDGSMRQGVKELDKWEAAKHVAYNALYGYTVDPTRGADHYLNERKVRRANNGK
LPRWARKYKRTIKIGNHTFYKGD"
gene 14938..15498
/locus_tag="BN405_2-10_Ab1_orf_28"
/db_xref="GeneID:14296580"
CDS 14938..15498
/locus_tag="BN405_2-10_Ab1_orf_28"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp031"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236849.1"
/db_xref="GI:431809961 UniProtKB/TrEMBL:K4RI22
GeneID:14296580"
/translation="MWAGCISLGYYTSAQVVTTGVVFVGELDHHRLNVNVAFTILLDFG
IFHNLTSLRLCHKLWTYNQIDEFCTPIPGTSRGPEAVLGHRRCRYKVQVVQTHSSVETQ
LADVLRFPSLGFKTPSRVVEFVSESIHELNDASNLDSRSIQELELLSRVDCSGHVDRLS
VEHFISSLFFRDKYTADYPASAN"
gene complement(14974..15435)
/locus_tag="BN405_2-10_Ab1_orf_29"
/db_xref="GeneID:14296581"
CDS complement(14974..15435)
/locus_tag="BN405_2-10_Ab1_orf_29"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp032"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236850.1"
/db_xref="GI:431809962 UniProtKB/TrEMBL:K4RM24
GeneID:14296581"
/translation="MFNAKSVNVTTAIDAAEEFQLLDTSAIQIRSVIQFMDALTYKFNY
TTGCFETQTREAKHISKLSFNTAVRLHNLYLVPTSTVTQYGFWAPAGAGYRSAEFIDLV
VSPELMAKAQASKIVKNAKIQKDRKGNIHIQSMMVEFPNKDYARRYNLG"
gene complement(15448..16656)
/locus_tag="BN405_2-10_Ab1_orf_30"
/db_xref="GeneID:14296582"
CDS complement(15448..16656)
/locus_tag="BN405_2-10_Ab1_orf_30"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_031"
/codon_start=1
/transl_table=11
/product="DNA ligase"
/protein_id="YP_007236851.1"
/db_xref="GI:431809963 GOA:K4RKV2 InterPro:IPR012310
InterPro:IPR012340 UniProtKB/TrEMBL:K4RKV2 GeneID:14296582"
/translation="MSYFQRLYGLDKKGGFKEWTVEVVGEEDGSFNIVVKYGKEHGAMT
SQVTNIRVGKQKRSVEEQAVSEAQSKVSKQLDKGYRAAKEELNDLPVMAMLAKPLDPAK
YKEGYGSPKLDGLRCMAKKANGVVTLASRMGKPYNVPHIIKELEEIMQEGDVWDGELYV
HGEVLEDINSAVKREDAYDKWMKAEKALDAYALENGEEEYDRLLNEVDSTSFIYGLRKR
MEFHVFDIVKEGLTFKERLVDFQFKAATVAGIGKIRFVEYVFCSTFEELKRLHDVYRQK
GYEGIMWRSPEGLYESGKRSSGLQKYKEFFDMEMQIVNYVVDKNGNAVLVVFDPVPQEL
LEVTYGDFDERKDQITNFENYRGKWLTVQIQSRFKKTLRAQFPTGKLIRAGRVIGGVFV
PEE"
gene complement(16653..17042)
/locus_tag="BN405_2-10_Ab1_orf_31"
/db_xref="GeneID:14296583"
CDS complement(16653..17042)
/locus_tag="BN405_2-10_Ab1_orf_31"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_032"
/codon_start=1
/transl_table=11
/product="putative dCMP deaminase"
/protein_id="YP_007236852.1"
/db_xref="GI:431809964 GOA:K4RMA7 InterPro:IPR002125
InterPro:IPR015517 InterPro:IPR016193
UniProtKB/TrEMBL:K4RMA7 GeneID:14296583"
/translation="MEAAEAFAKCSDSTRSKVGAVLVKRNRIISCGYNALPEHLNGPLE
DETGVTKAEVRHAEENALRALIRSPESAQGATLFVTHSCCKNCAISVVEAGIKVVYYKH
EYRLDEGLRHLRENDVLVIKYEEDQ"
gene complement(17072..17308)
/locus_tag="BN405_2-10_Ab1_orf_32"
/db_xref="GeneID:14296584"
CDS complement(17072..17308)
/locus_tag="BN405_2-10_Ab1_orf_32"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_033"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236853.1"
/db_xref="GI:431809965 UniProtKB/TrEMBL:K4RLA6
GeneID:14296584"
/translation="MTEPTEPTVMRIDDVIEALQTLRTVYGNLKVAEIEHGDPTWSYYP
PSVVYLTDTDEYYMEFACPEEGYYEEIAVLIGG"
gene complement(17318..17530)
/locus_tag="BN405_2-10_Ab1_orf_33"
/db_xref="GeneID:14296585"
CDS complement(17318..17530)
/locus_tag="BN405_2-10_Ab1_orf_33"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_034"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236854.1"
/db_xref="GI:431809966 UniProtKB/TrEMBL:K4RI23
GeneID:14296585"
/translation="MKDVAGRDIEIGDAVAFCLGGTGMVMLVGEVVAINPKTVSVKAEA
WDKWSGKPSVQVFLRRGDAVCKVEN"
gene complement(17527..17796)
/locus_tag="BN405_2-10_Ab1_orf_34"
/db_xref="GeneID:14296586"
CDS complement(17527..17796)
/locus_tag="BN405_2-10_Ab1_orf_34"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_035"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236855.1"
/db_xref="GI:431809967 UniProtKB/TrEMBL:K4RM26
GeneID:14296586"
/translation="MKVVKRNGHKLELESDEINMLVGLLGHLSASAATTDLGWFMEDLY
QELEVKSDPEAVNKYEQEFRAKAYGSDDPSDFVILIKGADGEYK"
gene complement(17805..18155)
/locus_tag="BN405_2-10_Ab1_orf_35"
/db_xref="GeneID:14296587"
CDS complement(17805..18155)
/locus_tag="BN405_2-10_Ab1_orf_35"
/inference="similar to DNA
sequence:INSDC:HQ832595:PaP1_gp036"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236856.1"
/db_xref="GI:431809968 UniProtKB/TrEMBL:K4RKV5
GeneID:14296587"
/translation="MTSKNSDLSTQMIDKIIAKESVVGQYTVAKQKVTVIDYEEFSRLD
FQPPATWFIKDASGYYIFVHTSQRAKAQAWIDEEYGKGRYTVNASRVQKKHNTGEGSKP
AYGVATRRGQKR"
gene complement(18136..18414)
/locus_tag="BN405_2-10_Ab1_orf_36"
/db_xref="GeneID:14296588"
CDS complement(18136..18414)
/locus_tag="BN405_2-10_Ab1_orf_36"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_038"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236857.1"
/db_xref="GI:431809969 UniProtKB/TrEMBL:K4RMA9
GeneID:14296588"
/translation="MSNLVWELVWEEDYEPDSRMGLWIGNPPSVEQLAEVLLGADWRLT
EDKVEEAAHSLLKSGGYKVSQYHALSLDSFFADTGLGKEVEIDLEEL"
gene complement(18411..18842)
/locus_tag="BN405_2-10_Ab1_orf_37"
/db_xref="GeneID:14296589"
CDS complement(18411..18842)
/locus_tag="BN405_2-10_Ab1_orf_37"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_039"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236858.1"
/db_xref="GI:431809970 UniProtKB/TrEMBL:K4RLA9
GeneID:14296589"
/translation="MTSSVAPMATSRRRTSPATAIISPANDALSCWTRRRRLPNGHQQA
EGGLLGMNSVWVIFGQLWDDYSGEFDLHMLGVLGNTKAETIRRVVSSYPGLPEPDEELL
DFIVAGLIVNAECEVDIPCGKTGKDEWVMYSIRKKEVYQ"
gene complement(18910..19212)
/locus_tag="BN405_2-10_Ab1_orf_38"
/db_xref="GeneID:14296590"
CDS complement(18910..19212)
/locus_tag="BN405_2-10_Ab1_orf_38"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_040"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236859.1"
/db_xref="GI:431809971 UniProtKB/TrEMBL:K4RI24
GeneID:14296590"
/translation="MRSMRDEFEAWFVRNYAAQIKDGHHGFTLDRYEHPPHQYIHDTPH
HDWRIWQASRAALRVELPEKMEPTRNIYGNLIIGSYNAVLDAVKEALQQAGIEVK"
gene complement(19200..19385)
/locus_tag="BN405_2-10_Ab1_orf_39"
/db_xref="GeneID:14296591"
CDS complement(19200..19385)
/locus_tag="BN405_2-10_Ab1_orf_39"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_041"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236860.1"
/db_xref="GI:431809972 UniProtKB/TrEMBL:K4RM28
GeneID:14296591"
/translation="MFELMQELEGQAIDNSKEGVYLQKIRKEWKYVEDYIHALEELALS
VMPSELLKEIQEDCGV"
gene complement(19446..19994)
/locus_tag="BN405_2-10_Ab1_orf_40"
/db_xref="GeneID:14296592"
CDS complement(19446..19994)
/locus_tag="BN405_2-10_Ab1_orf_40"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_042"
/codon_start=1
/transl_table=11
/product="putative protease subunit"
/protein_id="YP_007236861.1"
/db_xref="GI:431809973 GOA:K4RKV9 InterPro:IPR023562
UniProtKB/TrEMBL:K4RKV9 GeneID:14296592"
/translation="MPVSCTQSVSNRYSILLPYVIKSLEELTEELWTLENAGQNDEVYI
TINGCGGQVETANAIIRAIKECQAPVHARLEGECASAMTAIALACDSVEIDQFTYFMIH
APSFGVVSADFRNSLRNAAFSSAWCDKWVDHVYSDFLTEKELERVKAGEELYIGGEELE
DKLSDFFEKKRLAMEEISE"
gene complement(20042..20398)
/locus_tag="BN405_2-10_Ab1_orf_41"
/db_xref="GeneID:14296593"
CDS complement(20042..20398)
/locus_tag="BN405_2-10_Ab1_orf_41"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_043"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236862.1"
/db_xref="GI:431809974 UniProtKB/TrEMBL:K4RMB2
GeneID:14296593"
/translation="MKFNKAQREFFKDYAIQTVKSTLMQVAAQNGLEINQEALDRAMEV
VNLEPLAEAAGTAFLERVDFKTLVKVDKFVRTEEFLSVAQAGAEVGEAVSGELSTILLP
FFAMLGSGQKESEE"
gene complement(20395..20862)
/locus_tag="BN405_2-10_Ab1_orf_42"
/db_xref="GeneID:14296594"
CDS complement(20395..20862)
/locus_tag="BN405_2-10_Ab1_orf_42"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_044"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236863.1"
/db_xref="GI:431809975 UniProtKB/TrEMBL:K4RLB4
GeneID:14296594"
/translation="MQVINIVEYNPIVWLRSIHAHMKEGFRVVRSIEGYPVYGTLCQVQ
MFRQEGVPDEIEKELDGNEVVVQEWDVFSLLMGMQNAFDQGFRIDADDPHFANMSFALK
SVKMVREGAEKQTEEKSTEVAKEVPVEEVQETESEDKPKTRRRRTTKEKSE"
gene 20461..20886
/locus_tag="BN405_2-10_Ab1_orf_43"
/db_xref="GeneID:14296595"
CDS 20461..20886
/locus_tag="BN405_2-10_Ab1_orf_43"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236864.1"
/db_xref="GI:431809976 UniProtKB/TrEMBL:K4RI25
GeneID:14296595"
/translation="MDFLYRNFLSYFCRLFLSLLLCAFSDHLYRLESEAHVGKVRVVGI
DSEALIESVLHTHQKTENVPFLHNHFIPVKLFFDFIRNAFLTEHLHLTEGTVHRIAFNR
PNDTETFLHVGVNRAKPDDRVVFYDIDNLHILLLLAG"
gene 21335..21523
/locus_tag="BN405_2-10_Ab1_orf_44"
/db_xref="GeneID:14296596"
CDS 21335..21523
/locus_tag="BN405_2-10_Ab1_orf_44"
/inference="similar to DNA
sequence:INSDC:HQ832595:PaP1_gp044"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236865.1"
/db_xref="GI:431809977 UniProtKB/TrEMBL:K4RM30
GeneID:14296596"
/translation="MRCKCCDSELSFETPVINKHTGKEDDLCSSCRRFALNPTLDHEYF
GGWYPSEGVTAPLPTGD"
gene 21666..21989
/locus_tag="BN405_2-10_Ab1_orf_45"
/db_xref="GeneID:14296597"
CDS 21666..21989
/locus_tag="BN405_2-10_Ab1_orf_45"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_045"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236866.1"
/db_xref="GI:431809978 UniProtKB/TrEMBL:K4RKW3
GeneID:14296597"
/translation="MTQERNKGGRPTNAELEARGIIQTDLKAGLRLLKKSFAENIRFLQ
EQSDNPEVSLQMRIKLKKELSDMFVAYYKADIALKKELAKGTESGDNENTEEDKTPGVV
LAF"
gene 21995..22065
/locus_tag="BN405_2-10_Ab1_tRNA_01"
/db_xref="GeneID:14296598"
tRNA 21995..22065
/locus_tag="BN405_2-10_Ab1_tRNA_01"
/product="tRNA-Gln"
/db_xref="GeneID:14296598"
gene 22274..22346
/locus_tag="BN405_2-10_Ab1_tRNA_02"
/db_xref="GeneID:14296653"
tRNA 22274..22346
/locus_tag="BN405_2-10_Ab1_tRNA_02"
/product="tRNA-Arg"
/db_xref="GeneID:14296653"
gene 22357..22430
/locus_tag="BN405_2-10_Ab1_tRNA_03"
/db_xref="GeneID:14296654"
tRNA 22357..22430
/locus_tag="BN405_2-10_Ab1_tRNA_03"
/product="tRNA-Lys"
/db_xref="GeneID:14296654"
gene 22695..22776
/locus_tag="BN405_2-10_Ab1_tRNA_04"
/db_xref="GeneID:14296655"
tRNA 22695..22776
/locus_tag="BN405_2-10_Ab1_tRNA_04"
/product="tRNA-Leu"
/db_xref="GeneID:14296655"
gene 22986..23058
/locus_tag="BN405_2-10_Ab1_tRNA_05"
/db_xref="GeneID:14296656"
tRNA 22986..23058
/locus_tag="BN405_2-10_Ab1_tRNA_05"
/product="tRNA-Ile"
/db_xref="GeneID:14296656"
gene 23071..23146
/locus_tag="BN405_2-10_Ab1_tRNA_06"
/db_xref="GeneID:14296657"
tRNA 23071..23146
/locus_tag="BN405_2-10_Ab1_tRNA_06"
/product="tRNA-Asp"
/db_xref="GeneID:14296657"
gene 23561..23633
/locus_tag="BN405_2-10_Ab1_tRNA_07"
/db_xref="GeneID:14296658"
tRNA 23561..23633
/locus_tag="BN405_2-10_Ab1_tRNA_07"
/product="tRNA-Cys"
/db_xref="GeneID:14296658"
gene 23785..23859
/locus_tag="BN405_2-10_Ab1_tRNA_08"
/db_xref="GeneID:14296659"
tRNA 23785..23859
/locus_tag="BN405_2-10_Ab1_tRNA_08"
/product="tRNA-Pro"
/db_xref="GeneID:14296659"
gene 23870..23943
/locus_tag="BN405_2-10_Ab1_tRNA_09"
/db_xref="GeneID:14296660"
tRNA 23870..23943
/locus_tag="BN405_2-10_Ab1_tRNA_09"
/product="tRNA-Gly"
/db_xref="GeneID:14296660"
gene 24009..24081
/locus_tag="BN405_2-10_Ab1_tRNA_10"
/db_xref="GeneID:14296661"
tRNA 24009..24081
/locus_tag="BN405_2-10_Ab1_tRNA_10"
/product="tRNA-Phe"
/db_xref="GeneID:14296661"
gene 24091..24162
/locus_tag="BN405_2-10_Ab1_tRNA_11"
/db_xref="GeneID:14296662"
tRNA 24091..24162
/locus_tag="BN405_2-10_Ab1_tRNA_11"
/product="tRNA-Glu"
/db_xref="GeneID:14296662"
gene complement(24219..24500)
/locus_tag="BN405_2-10_Ab1_orf_46"
/db_xref="GeneID:14296663"
CDS complement(24219..24500)
/locus_tag="BN405_2-10_Ab1_orf_46"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_058"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236867.1"
/db_xref="GI:431809979 UniProtKB/TrEMBL:K4RMB4
GeneID:14296663"
/translation="MLKGQGIEPVRRERRRKPFSTGEEERVSCCGIEPPIALLREPAIL
ALLAYDPESLKASTRYTIARHWLEAGTRTPTIGSQPKGSIRATQSPHE"
gene 24622..26142
/locus_tag="BN405_2-10_Ab1_orf_47"
/db_xref="GeneID:14296599"
CDS 24622..26142
/locus_tag="BN405_2-10_Ab1_orf_47"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_059"
/codon_start=1
/transl_table=11
/product="terminase large subunit"
/protein_id="YP_007236868.1"
/db_xref="GI:431809980 InterPro:IPR004921
InterPro:IPR006517 UniProtKB/TrEMBL:K4RLB7 GeneID:14296599"
/translation="MENTKVPDKKLGPIALALKEARENFDLSPHVIGPKSFKQKEFTDS
DAKITVFGGAAGAGKSYLGVMDFMKYIHDPNFRGVMTRRTTPQIKGPGGLLEKATDLFK
LVDPKVKWKDKDGKFVFSSGAVIFLRHFEQESDKDSFQGWEVSKFLVDEGQQFTEGMVT
YLISRMRNPKCSVVPHMKITCNPDYNSFLRKWIEWWLDPDTGIPIPERSGVTRWFVRKG
GKMFWGDTKEECIALHGNPSLAPDDEDQVKPISFKFIAANCFDNPILMLNDPEYVANLE
ALPRVEREKLLDGSWHAREEGAGYFTRDWCQIVPHPPLRVLKRVRAWDISGSIESETNR
NPDWTAGVLMSRTKEGLFTVEDVVRERRLFGGVFDLILETAKQDGQDVEIQIPCDPGAA
GKAYAAQLIRDLADHGFHARPKTTNKSKVTRFAPFVSVAETKSVQVVAGDWNEDYFDEL
ERFDGSKAIKDDQVDATSDAFNALSLGSLIIPDFLPPDMTQSNKFKLN"
gene 26155..27594
/locus_tag="BN405_2-10_Ab1_orf_48"
/db_xref="GeneID:14296600"
CDS 26155..27594
/locus_tag="BN405_2-10_Ab1_orf_48"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_060"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236869.1"
/db_xref="GI:431809981 InterPro:IPR009279
UniProtKB/TrEMBL:K4RI26 GeneID:14296600"
/translation="MAETEKTAPGIPRLRLGEIGSTGLKQVNGTILEERRPELRFPRAC
RTFQMMAEDPTIKSALDLFEMMMSRVDWEVDLGVDPDEAMKARGKFLKECMHDMEHSWY
SFIKEVTSFYTYGFSVHEMVFKRREGYPVSKYNDNKFGIKKLPIRSQSTITKWLYSEDG
RNFLGCEQSLANVVNGDRYVNLGNKDGTVEIPAKKMLLFRVDAKRDSPEGNSPLRACYN
AWRYRVEIEEQESVGVTRDMNGMPTLYLPPRYMSEDATEAERAVYEYYKRVIRNIQMNE
QSGLILPQAFDPESRQPLFKFELTSSQGSKMYDTDAIIRRWDNKILQALFADMLKMGQD
QVGSYSLAGAKTNIMAMAIESRLREIKDVLDNKLIPTLFALNGDYSPDLPKLQYGELDE
IDLEEFSKGIQRIGSVGGLERDREVYNKIRKALKIKPRPDDEPVDVDNIMGGQSQAGKA
GVGNGASTSAAGRDNAAANNA"
gene 27604..28074
/locus_tag="BN405_2-10_Ab1_orf_49"
/db_xref="GeneID:14296601"
CDS 27604..28074
/locus_tag="BN405_2-10_Ab1_orf_49"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_061"
/codon_start=1
/transl_table=11
/product="putative methyltransferase"
/protein_id="YP_007236870.1"
/db_xref="GI:431809982 GOA:K4RM32 UniProtKB/TrEMBL:K4RM32
GeneID:14296601"
/translation="MLTLESVIEALSNAFGAPAKAEEAPAVEVTKSLDNEKRMALFVVL
EPQEGDSTTDLHADTYSEEEVEKACINFNTHCNVANIFHKIETQEAEIVQSFIAPSAFT
TDDGREIKKGTWLQWWHFPEGSEVADALWEGVKSGEFTGVSIGARATVEDIE"
gene 28071..28988
/locus_tag="BN405_2-10_Ab1_orf_50"
/db_xref="GeneID:14296602"
CDS 28071..28988
/locus_tag="BN405_2-10_Ab1_orf_50"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_062"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236871.1"
/db_xref="GI:431809983 UniProtKB/TrEMBL:K4RKW7
GeneID:14296602"
/translation="MTVKAKRKLTDIKFEHEGAHVALVSKLQGGAANGHTTLITKATNG
VTEELIDKAAEVTVTMQFPEFLRKFFGMYYEDAEVLSVAMGYGRTEYPELDHKDWIDQR
VESMSILKSVYKSADLNQALSELTPEQTLSLKQDQELLEKALEVVSEQSNENPSKEITN
METILKSAHLEALADAIAVEKAAGVAAVAEVQKQLDAANVELTALREIVKAAEAEKTAA
IAKARKEQLAEVLPADQVEDTFKSLEVLDDQAFAQTVGTLRILKAAADQNDMLVEKGVS
GAGEEDDSVVAGVAAILKARHGSK"
gene 29016..29426
/locus_tag="BN405_2-10_Ab1_orf_51"
/db_xref="GeneID:14296603"
CDS 29016..29426
/locus_tag="BN405_2-10_Ab1_orf_51"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_063"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236872.1"
/db_xref="GI:431809984 UniProtKB/TrEMBL:K4RMB6
GeneID:14296603"
/translation="MAQNIIAKDHQRLSNWLKEEQMGHRGLFYTRETLPVADIDVKTTG
SVLDSTGKLVTKATIADATYILITDLHDYANAQMSHAVVLARGFAKIGSKAVIFGADVD
DADKATVFEAFKAKNIFAVDQIEGAFENVTFA"
gene 29471..30505
/locus_tag="BN405_2-10_Ab1_orf_52"
/db_xref="GeneID:14296604"
CDS 29471..30505
/locus_tag="BN405_2-10_Ab1_orf_52"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_064"
/codon_start=1
/transl_table=11
/product="Major capsid protein"
/protein_id="YP_007236873.1"
/db_xref="GI:431809985 InterPro:IPR005564
UniProtKB/TrEMBL:K4RLC0 GeneID:14296604"
/translation="MANTRSYLNDGQFYIADQTENLLIIPNTWTLVENMGVFTSEGVTQ
NTVQFEEIETRYGLVKDAIRGTRHQVASDQRRQLRAFAIPHFNQDDYITPEDIQGKRAF
GADREETLNEVRARKLETIRRNWANTAEVASVSAIVTGKSYAPAGTIEYDWYDLMGKTR
KVVGFDLTNPTADVMGKTEEIFVHMQDNSQDGLIRGDFVALCSPEFFTALINHPSIKEF
YKAYQASPQYWRERLTARGLDLRFREFYFGNIHFIEYRGVDPYGNRLIPAGDAYFIPTD
SGDLFARYFGPGSTFDDLGTLGKELYATERMAEDRRSILIETESNFIHVLRRPQMIVRG
TVNA"
gene 30556..31032
/locus_tag="BN405_2-10_Ab1_orf_53"
/db_xref="GeneID:14296605"
CDS 30556..31032
/locus_tag="BN405_2-10_Ab1_orf_53"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_065"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236874.1"
/db_xref="GI:431809986 UniProtKB/TrEMBL:K4RI27
GeneID:14296605"
/translation="MAYTGDPANNPIDRLREIVGDVWEPPMLSDETYQWVLDKNEGNER
RAALELMRMMLFRLTRGMRERTGDIEVYGAEYFNNYLKALQLILKDPNITISLAVPYAG
GISKSDMLANDLDPDNVTREFYIGFARREKLYNQCNPGPQDLSIGCDYLGKLQF"
gene 30941..31483
/locus_tag="BN405_2-10_Ab1_orf_54"
/db_xref="GeneID:14296606"
CDS 30941..31483
/locus_tag="BN405_2-10_Ab1_orf_54"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp056; similar to
Pseudomonas phage SN hypothetical protein (YP_002418836)"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236875.1"
/db_xref="GI:431809987 UniProtKB/TrEMBL:K4RM33
GeneID:14296606"
/translation="MQDGRSFTTSATPVLKTLALGVIILASFSFKTDRRRLTSLIKRVE
ALDGTTVEVGFFPEDRYGSENGNLPVAQVAAYNEFGTTRNPTRPFMAPTFEEFTSQFHY
ARLMKSTFENVIRDGRQVNTLLKKLGRMVAEQMQVNIDDYPGSNSPAWAAYKGFNDPLF
HTGKMLESVKFQIHRRQ"
gene 31483..31863
/locus_tag="BN405_2-10_Ab1_orf_55"
/db_xref="GeneID:14296607"
CDS 31483..31863
/locus_tag="BN405_2-10_Ab1_orf_55"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp057"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236876.1"
/db_xref="GI:431809988 UniProtKB/TrEMBL:K4RKX2
GeneID:14296607"
/translation="MLYPTFSMTNFVKLDLIRRGQPGDDGFGRPTPPVETVVTITANVQ
PIEKSTDTRILPEADRSKACFKVYSRGEEIRQLKEGPNGWSADRFIWEGELYEVMKVIN
YSMGILNHYKAICMRVERNSTA"
gene 31860..32423
/locus_tag="BN405_2-10_Ab1_orf_56"
/db_xref="GeneID:14296608"
CDS 31860..32423
/locus_tag="BN405_2-10_Ab1_orf_56"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_068"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236877.1"
/db_xref="GI:431809989 UniProtKB/TrEMBL:K4RMB8
GeneID:14296608"
/translation="MIHTELENSLYLMIKELFPDWRVIQAYTNNQEPQTPYLAIDIKKL
DELGRENVSNMSDPISPSHGTVQVQQDFAAKVVFELVGKYGETASVSDMAMAITRALRT
PAGHAAQRKFNLSLFKLPSTRRVPMLRETDMYMFYQVTCEFGFSVIETTTQEFAAGADI
HGVYYDAGRPGHIIESHIDINFEH"
gene 32436..33722
/locus_tag="BN405_2-10_Ab1_orf_57"
/db_xref="GeneID:14296609"
CDS 32436..33722
/locus_tag="BN405_2-10_Ab1_orf_57"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp059; similar to
Enterobacteria phage Felix 01 Phage conserved structural
protein (NP_944896) and Bordetella petrii DSM 12804
hypothetical protein (YP_001629590)"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236878.1"
/db_xref="GI:431809990 InterPro:IPR021808
UniProtKB/TrEMBL:K4RLC4 GeneID:14296609"
/translation="MTVLTDVIDIQISRETAAVAQTNFNVPLFIASHTNFSERARVYNS
LKGVAEDFGESDPTYLAAVRYFGQALKPRSLVIGRRQVPSATVSVSVVQEGQSYVLTVN
GLPVSYVSHQDDTATLIATGLKAAYDVTPVVGVTVTDNEDGTLTVASNGDWSLKVSSNL
TMAAAPSTEGWPATITAVQGENDEWYALSIDSHADDDIMAVATHIEGTKKVFIGATAQA
NTKTSAENDIASRLVAAGFQRTALIYHPNADAQFPECAWVGYQLQEQPGSNTWTHKALA
AVDAYRLTPTESTNLKNKNVTTFERVGGVNRTFGGAMAGGEWIDVMIFVDWLEARMTER
LWFRMANSKKIPYDAVGATILESEIRAQLNEGIRVGGLAEAPAPKVFVPDVLSMSPNMR
AQRIFEGIEFEARLAGAIHFVHIRGTVTV"
gene 33753..34277
/locus_tag="BN405_2-10_Ab1_orf_58"
/db_xref="GeneID:14296610"
CDS 33753..34277
/locus_tag="BN405_2-10_Ab1_orf_58"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_071"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236879.1"
/db_xref="GI:431809991 InterPro:IPR021695
UniProtKB/TrEMBL:K4RI28 GeneID:14296610"
/translation="MAVQRLATFSPADVTIVITHPATGESMVLGGFSEDSIVNIERNAD
TYVMYTGADNTSTRVYNASKSATLTVSLQQTSPSNDFLTALYNYDDARRSSEGLFTIHV
KDNSGRSDYFSDDAYVGVVPGSNFSNSMQTRDWVIHAHNLQTLIGGNAKLSPGDADTLR
NLGVTLDQRWL"
gene 34352..34852
/locus_tag="BN405_2-10_Ab1_orf_59"
/db_xref="GeneID:14296611"
CDS 34352..34852
/locus_tag="BN405_2-10_Ab1_orf_59"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp061; similar to
hypothetical protein NTHI"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236880.1"
/db_xref="GI:431809992 UniProtKB/TrEMBL:K4RM35
GeneID:14296611"
/translation="MITTYSPRDVVVTLAGIHSVTGYAEGEFIRIVKDIKPFIKHGSMD
GEIARVYNKDQGWRVELTIMQSSPTNDILSMLYNVDIATRMGKFPLMIKDTKGSTSFLA
LTAWVEDLPRVSFSGQLETRTWILGCSEVAMNIGGNVDQSLVEQAILLGSSLLPALTQF
GGF"
gene 34852..35331
/locus_tag="BN405_2-10_Ab1_orf_60"
/db_xref="GeneID:14296612"
CDS 34852..35331
/locus_tag="BN405_2-10_Ab1_orf_60"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_073"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236881.1"
/db_xref="GI:431809993 UniProtKB/TrEMBL:K4RKX6
GeneID:14296612"
/translation="MANTVLTYSPSDVKIVLCGYALTGVVSFEMSWLSRPYTMVRGIRG
HHTRVFNRDLSAQIRIEVLQTSVSNDAFFSLVEQDRRTQSARITLSVKDTHGSTMMSTD
NAYVNGYPSITFTDGIENRVWTIDVLDWTDGTVGGNQQVGFDVFGTVQGALSYLR"
gene 35345..35716
/locus_tag="BN405_2-10_Ab1_orf_61"
/db_xref="GeneID:14296613"
CDS 35345..35716
/locus_tag="BN405_2-10_Ab1_orf_61"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_074"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236882.1"
/db_xref="GI:431809994 UniProtKB/TrEMBL:K4RMC1
GeneID:14296613"
/translation="MFGNQRTVIHNGTEYTINLLPATRGISVLKQLTSLLGPSLAKYQA
DHDFSGAMKELFDNIDKVPVENLIQNLMLTVFKGSMAINFDTEFAGKYDLLYALTKDVI
EFNFGSVFSLIGFAEAPTV"
gene 35973..38339
/locus_tag="BN405_2-10_Ab1_orf_62"
/db_xref="GeneID:14296614"
CDS 35973..38339
/locus_tag="BN405_2-10_Ab1_orf_62"
/inference="similar to DNA
sequence:INSDC:HQ832595:PaP1_gp061"
/codon_start=1
/transl_table=11
/product="putative tape measure protein"
/protein_id="YP_007236883.1"
/db_xref="GI:431809995 InterPro:IPR013491
UniProtKB/TrEMBL:K4RLC7 GeneID:14296614"
/translation="MITERIAQLTGELKFTVDSRPLTAFDKKLAGVEARLREFSKLTNK
RFGVKLTLDTKTLREELAKAATQRVVLKNIAVDAAAVRLISEKLQERLNATPIRLKSVR
LDLSGIRDQKNFVKTALGQTKVDLPVELGLAQASRTLYEWKKRTESRFKIHLNADISRS
KLLQNARNTLRDVQGRLNGLAVATPQIRLSVDRAHLRREIQDVLEQIRREVRIRIDLES
SIRGGGAGGSRGTAGHIRQGMGMGIGSELAGWGRGFIPGLGGAFAIMQLNRANQELQGQ
RLAMQAVGGGVQGGQELQATLRDISQRLGLDDRAIGSSYVKMMAAGQASNFDKTQVDGI
FQSMAEYGRVMGLDGEAMKGSFRAVEQMMGKGQIMSEELKGQLAERFPAAVALMAKSQD
MTIAELMKTMEKGELKSDALIPFARTLAEEARKGGALDAAMQGTAAQQGRFQFGWNRTI
EAFAAGGFDRGMSDFFKIAAQGMKEALPLVTALGGGFEALMRPVNALVGIGGELGSQWE
NIAKQFNMTGTGLTLTTAQTLALLTPMGRLISAISWGALALEDFIVFLEGGDSVFGDFL
NNNVQAAETFEKLASESSELKNNLDGIFSVVPGLAEALKGLEFNEMLVSTMRELAAIME
FFNSVVERFAIAGKYRDAKIAEAGGDRSTIMSNIDTMYAMFNPEDAKDKATFIGDRLVA
QNIDAIQTETHTRATQSLTPDQFGYMMQRGQVRNEMEGALKKSAIDISFNLNVSGIDAQ
GNVMTTEAQERVREIVSNVLEEEISRASASYKESQ"
gene 38336..39097
/locus_tag="BN405_2-10_Ab1_orf_63"
/db_xref="GeneID:14296615"
CDS 38336..39097
/locus_tag="BN405_2-10_Ab1_orf_63"
/inference="similar to DNA
sequence:INSDC:HQ832595:PaP1_gp062"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236884.1"
/db_xref="GI:431809996 UniProtKB/TrEMBL:K4RI29
GeneID:14296615"
/translation="MTIAIKRENGDLIWFDAVTEFGRQYRGSVSSNPIETGGKITDHIT
TENPVFTLTAIVSDADFNLNRPVINDNEAQTYKINNKEFVNTQPVSVPAVITTSRFDPS
RIFPEVITQFIPPEIPSATVLPQKGDKVAYDIERQLIDMQRNAEVFSLLDFRDGIIWDQ
IERCIFTDLSFTENAETGSSLQPRMTIEAVTFTDTRYIEVRVNKGRKTAKKEKRDTKEG
DTEASNATSQDSPTFKRSQMKEAQIRTQVAR"
gene complement(38507..39163)
/locus_tag="BN405_2-10_Ab1_orf_64"
/db_xref="GeneID:14296616"
CDS complement(38507..39163)
/locus_tag="BN405_2-10_Ab1_orf_64"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236885.1"
/db_xref="GI:431809997 UniProtKB/TrEMBL:K4RM37
GeneID:14296616"
/translation="MRICTSGLGREEVCRYKSCSFSLPRNLSSNLSLFHLTTLECRRVL
AGSIASLGITFFGVSLFFLSGLSTLVNPNLDITSVCECHSLDCHTRLKAATCLGVFSER
QVGEDASFDLIPDDTVSEVQQTEDLSITLHVDQLALNIISDFITLLREDSCRRNLRRNK
LSNNFREDSARIKSRSCDNSRHTDRLSIHELFIVDLVCLGLVVVDNGPVQVEVCV"
gene 39103..39459
/locus_tag="BN405_2-10_Ab1_orf_65"
/db_xref="GeneID:14296617"
CDS 39103..39459
/locus_tag="BN405_2-10_Ab1_orf_65"
/inference="similar to DNA
sequence:INSDC:HQ832595:PaP1_gp063"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236886.1"
/db_xref="GI:431809998 UniProtKB/TrEMBL:K4RKY0
GeneID:14296617"
/translation="MSTTYIDTLPLYQDRKYRYAVAIEGISRVLQFYWNSRSRQWHMDI
FDEELNPILTGLAVVPQYPIMADYAMQHIGFNGYFLLMPVNLEQVQYKHDASDIVPQFF
ELLYVNVDLEDDVE"
gene 39549..40373
/locus_tag="BN405_2-10_Ab1_orf_66"
/db_xref="GeneID:14296618"
CDS 39549..40373
/locus_tag="BN405_2-10_Ab1_orf_66"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_079"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236887.1"
/db_xref="GI:431809999 UniProtKB/TrEMBL:K4RMC3
GeneID:14296618"
/translation="MNREGLQFRFDISKSSDNKKSGNSATVEIYNLSIATLNILETEYL
TCRLEVGYKEMGTSVVLDGNVVETSTRKSGNDYVTQLILGEGYTALTETKLKGTVSPGK
TVKDVIEEIRLQMPGVDRGAYTGLNCNNPIMYGYQLRGLAKDALNSVCEANNIEWNISG
NVLNVTDVNGPTTKSVQMAPLVNRETGLIDIPFYASASGTAQKKDQRRRRGVQFKCLLN
PELTPGVLVRVESDRLSGTFRINNVRISGGYRDNEWYTECWCSDLNQEDIDQ"
gene 40370..41110
/locus_tag="BN405_2-10_Ab1_orf_67"
/db_xref="GeneID:14296619"
CDS 40370..41110
/locus_tag="BN405_2-10_Ab1_orf_67"
/inference="similar to DNA
sequence:INSDC:HQ832595:PaP1_gp065"
/codon_start=1
/transl_table=11
/product="putative baseplate protein"
/protein_id="YP_007236888.1"
/db_xref="GI:431810000 UniProtKB/TrEMBL:K4RLD0
GeneID:14296619"
/translation="MRRTGLQELLNLHSSTEGSKQYTAIPCVVLRVLDDFRRLSVDVRP
VVNDLYKDGTSEEQPEILSVPVIMPGTANTLISFPLNVGDTVLCVFSQRTMDVFKGSAT
GQPHTPNDLRKFNMADAIAIPGLFTFPRSMNDPARHSWPHDTKDLTIAHNLMTGQEAEV
RIKANGDILINSRKTISINAQNVNVKCASLTVDAAHTTWNGNIAHTGNYVQTGGTSTFN
GIPFHTHKHGGVMPGGGVTAVPQA"
gene 40950..41492
/locus_tag="BN405_2-10_Ab1_orf_68"
/db_xref="GeneID:14296620"
CDS 40950..41492
/locus_tag="BN405_2-10_Ab1_orf_68"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_081"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236889.1"
/db_xref="GI:431810001 UniProtKB/TrEMBL:K4RI30
GeneID:14296620"
/translation="MLMQPIQHGTGTLHIQVTTCRLVEPLHSTVFHSIPTNTVVLCRAV
VLLLSHKLKGDHMDLFVNPDTHDLVFINGEAPVTQRMVDIVAQRLKIKLYTFLGEWFLD
DRIGIPYFERILGKSRSLPAVDAIFQSEIMRDPGVLEITSWQSGIDPHTREYSMEFTVR
TTDNTESLPITFRMIGV"
gene 41494..42957
/locus_tag="BN405_2-10_Ab1_orf_69"
/db_xref="GeneID:14296621"
CDS 41494..42957
/locus_tag="BN405_2-10_Ab1_orf_69"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_082"
/codon_start=1
/transl_table=11
/product="Putative baseplate component"
/protein_id="YP_007236890.1"
/db_xref="GI:431810002 UniProtKB/TrEMBL:K4RM39
GeneID:14296621"
/translation="MAGITAEGLTIKDLDQILTDYRNVASQVFADLVSTGDEVDTSGNS
ALGRLIGVVAPSDEAIWEVIQMVYNSFNPAAATGVALDNLVSFSAISRHAARPTRAQVV
LEGNIDTVINSPPAKMISSSTGRVFHLLQGVILTPKACSGVGIFPQTVGNDLTYELKMY
VDDINTTSIKYTSPATGTVTSESILAGLAADVATNHGNTLTSYEQNGILFIVPIDPFNT
KTFEEASNLSIQKVRKLGIAVDDVIGPVPQQALAIDTISIPIAGWDSVINPVPAITGRL
RETDDELRERFRNSKFVQATNILESLIDGLMNVEGVEDVRIIENDTDNPDPVHGVPGHS
FLPIVLGGIPTEVAQSIWLNKPFGIGSVGDTEVQVVDSLGYTHRVNYQRPVEVPIEIKI
SVTNTGSMPENIEDILRPRIVAYGTENYKIGDDVIYSRFYAPIMEIPGFQVNSLTIAKK
GQTQGMANIEIGFKEVATFAAADITVTTV"
gene 42976..43707
/locus_tag="BN405_2-10_Ab1_orf_70"
/db_xref="GeneID:14296622"
CDS 42976..43707
/locus_tag="BN405_2-10_Ab1_orf_70"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_083"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236891.1"
/db_xref="GI:431810003 InterPro:IPR021283
UniProtKB/TrEMBL:K4RKY3 GeneID:14296622"
/translation="MAVNQFDREDYLEVARERVTEQFKEKPIFDRFLQVLLSGKFDIQN
ALEDLQTLRSLDTATGKQLDIIGDIVGRPRGLVYQDIFNYFGFAGTERAGSFGSLSDPT
VGAPWYSVGAPTGNAREPSDEEYRMILKAKIIKNRTNSTPEQVIEAYKFVFGVPEVFLE
EYAPAAVRVGIGKILTNVERSLLFDLGGAGALLPKTIGVNYTYTEFQAGRVFATEGFPG
GQGVGDLNDPTVGGILTNLVT"
gene 43718..45733
/locus_tag="BN405_2-10_Ab1_orf_71"
/db_xref="GeneID:14296623"
CDS 43718..45733
/locus_tag="BN405_2-10_Ab1_orf_71"
/inference="similar to DNA
sequence:INSDC:HQ832595:PaP1_gp069"
/codon_start=1
/transl_table=11
/product="putative tail fiber protein"
/protein_id="YP_007236892.1"
/db_xref="GI:431810004 UniProtKB/TrEMBL:K4RMC5
GeneID:14296623"
/translation="MADYSQLPIENIWSTGGDMVAPTPAQQQGGWGIQSVPRQWWNWKW
NLHDTNLAYLLQKGIPEWTSTQEYIANKSFCTRGGFVYKAVRTHTGSDPATANPNWARA
FADFTTSSSALGSLTPRDGGIPFFISATGASVFDSTAYGRGMLNVANAAAARNYISAQE
SSVVLSNLSTVTRAANTVPYFNTDTSMATFNITAFGRGLVNAANAENARNFLGLANSAI
ITADPANRAHTLVYRDAAGNFNAGVITATLSGNATTANKLRTPVTINGVAFDGSQNIVL
PGLDTSYAGTVARLHINGANLSSADKTTQLALRNKSDNDWISLAVVDDNILQFVFRSAT
NPVVQIGNEVILHTGNQFSLGPTLTDARSRLGLDRLTQGSSDTQVFPSTLNNGPYLTVQ
PTAIGGFNGSTNGWLFRFDANGNMTHGTVPAARITGLSNSAQIPATTTAQANSLVQRDA
DGGFSAIAINAYGTIVGYGSNIFSRASGTGNAHIGFQRANGTELGLIWGAQSNNSMNFR
VAGGSTAVSITGLDMTVTGRVNATTLNASGNVNATGNVNAGSATLNTAGNITGAAYGAY
GSLTNWVDSVYAKKGEIPNDIARAGAAWDAVGQYILAGDQSGGSGGPGTTRAGSQLKPY
STISYTAGALPAAGTYRCMGAFAGGGNQITLWQRIS"
gene 45800..46147
/locus_tag="BN405_2-10_Ab1_orf_72"
/db_xref="GeneID:14296624"
CDS 45800..46147
/locus_tag="BN405_2-10_Ab1_orf_72"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp075"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236893.1"
/db_xref="GI:431810005 UniProtKB/TrEMBL:K4RLD3
GeneID:14296624"
/translation="MGFECEVNHPQWGWIPFYACDYDDRAKLVYDAISRAVDNGEIPEP
KDVTDRDLVVDARLWRDNELTRADRQVEIAIDDEDEVKEKAWRKYRSALRKWPEHKNFP
AEKSKPKAPKE"
gene 46159..47658
/locus_tag="BN405_2-10_Ab1_orf_73"
/db_xref="GeneID:14296625"
CDS 46159..47658
/locus_tag="BN405_2-10_Ab1_orf_73"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp076"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236894.1"
/db_xref="GI:431810006 UniProtKB/TrEMBL:K4RI31
GeneID:14296625"
/translation="MPNIMKPTGINAIWSENGQKVDPGAVKVGLGWVTELPPYQTANFI
EYKQDLFNAHVNQHGIPEWDSVTEYQGNLSYTQGANGIIYKCLRTHSDKIPTDPLNITA
GYWRVAYEDAGEAAKVQANLDRHVTNYNTLSGIGNVVIARQNLSVYSKAEGDARYAMRH
GNGSNVFSVAPATQPTHAIPLSQLSTLVPPATETVAGVMAVATTIETEAGANDTKAVSP
LKAAQVYLKKKDNLSGLSNVTAARANLGLSDTATMPSSTFLKAGSNLADVPNKALARSN
LGITSSATQPETYFLRSAQNLADVPNKAQARVNLGLTGMATTDPAAVMMKADNLAGLAN
TATARSNLGLGTASTRNTGDFLSSGDNLSDLTNVQAARNNLGLKGAATLDVWGLPANTT
AMDFQSSQSDISRGWARLPNGLLLQWGTGPGLSDDTRTNIQLPVPARILNVQVTVMGTF
NNSIGPGAFMTDMWSNTGFRVSCNWGNWSYPFNWFAITSTL"
gene 47636..48235
/locus_tag="BN405_2-10_Ab1_orf_74"
/db_xref="GeneID:14296626"
CDS 47636..48235
/locus_tag="BN405_2-10_Ab1_orf_74"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp077; similar to
Ralstonia phage phiRSA1 hypothetical protein RPRSA1_gp14
(YP_001165263), Pseudomonas phage phiCTX hypothetical
protein (NP_490609) and Ralstonia solanacearum GMI1000
putative phage-related protein (hydrolase; NP_520052)"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236895.1"
/db_xref="GI:431810007 InterPro:IPR024408
UniProtKB/TrEMBL:K4RM41 GeneID:14296626"
/translation="MLSLQPCNSGVLKMALTEQDFQSAADDLGVDVASVKAVTKVESRG
SGFLLSGVPKILFERHWMFKLLKRKLGRDPEINDVCNPKAGGYLGGQAEHERLDKAVKM
DRDCALQSASWGLFQIMGFHWEALGYASVQAFVNAQYASEGSQLNTFVRFIKINPAIHK
ALKSKNWAEFARRYNGPDYKKNNYDVKLAEAYKSFK"
gene 48253..48492
/locus_tag="BN405_2-10_Ab1_orf_75"
/db_xref="GeneID:14296627"
CDS 48253..48492
/locus_tag="BN405_2-10_Ab1_orf_75"
/inference="similar to DNA
sequence:INSDC:HQ832595:PaP1_gp073"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236896.1"
/db_xref="GI:431810008 UniProtKB/TrEMBL:K4RKZ8
GeneID:14296627"
/translation="MKKLLKSWKFWAAVGSATFMALEAMVHLWEPILPPGVFAAVATLV
AVGVRISAVFVTAGKVEEAISETIEDGSIENDTN"
gene 48479..48922
/locus_tag="BN405_2-10_Ab1_orf_76"
/db_xref="GeneID:14296628"
CDS 48479..48922
/locus_tag="BN405_2-10_Ab1_orf_76"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp079"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236897.1"
/db_xref="GI:431810009 UniProtKB/TrEMBL:K4RMD0
GeneID:14296628"
/translation="MILTKLKNYALVVAAAMAAGFGYLSFSLYGDLAVAKNDIQSLQAA
SRQMEEQFQKERAGCEITTGRLEAHIAQMKSRQELLQGHLCELESLPNPTPRETQENAT
ETISEPSTGDSLDPALTSLLDRAFCSAVPNDPYCAPGKPDRGG"
gene 49054..49359
/locus_tag="BN405_2-10_Ab1_orf_77"
/db_xref="GeneID:14296629"
CDS 49054..49359
/locus_tag="BN405_2-10_Ab1_orf_77"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_091"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236898.1"
/db_xref="GI:431810010 UniProtKB/TrEMBL:K4RLE7
GeneID:14296629"
/translation="MESKDGKEGLIKVATQGVISLLIAILMAWSGFLSSSLSKQEERIF
AMQRDMVSEAKLNALESRFNSRLESEISNVRREQQETNRYLILIMNAVKGRDTETQ"
gene complement(49757..50065)
/locus_tag="BN405_2-10_Ab1_orf_78"
/db_xref="GeneID:14296630"
CDS complement(49757..50065)
/locus_tag="BN405_2-10_Ab1_orf_78"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp081"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236899.1"
/db_xref="GI:431810011 UniProtKB/TrEMBL:K4RI32
GeneID:14296630"
/translation="MELFDVKKGQVVMVGSLDIDIPRPTFEKTNARMTGVVVDIDEGSM
HLNVKVLFDNGAMDWGNASDIKLLHSGPEANKVRKKLAKKVIQKLDDLFDEVYQVVR"
gene complement(50077..50424)
/locus_tag="BN405_2-10_Ab1_orf_79"
/db_xref="GeneID:14296631"
CDS complement(50077..50424)
/locus_tag="BN405_2-10_Ab1_orf_79"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_093"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236900.1"
/db_xref="GI:431810012 UniProtKB/TrEMBL:K4RM47
GeneID:14296631"
/translation="MQKAARRCRMSLQYMVSGDEHIDDYATYELSYPDLKATYNRLSKL
DDSSFKASMPEVLHFCCFVAWIKEIPSSILLGDRGLIHLIAHHIHEGAEDDGPQAFKSL
RHQFNTLMKLD"
gene complement(50399..51274)
/locus_tag="BN405_2-10_Ab1_orf_80"
/db_xref="GeneID:14296632"
CDS complement(50399..51274)
/locus_tag="BN405_2-10_Ab1_orf_80"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp082; similar to
Burkholderia phage BcepMu gp06 protein (YP_024679) and
Psychrobacter sp. PRwf-1 hypothetical protein
(YP_001280245)"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236901.1"
/db_xref="GI:431810013 UniProtKB/TrEMBL:K4RL08
GeneID:14296632"
/translation="MTAACWYAVIAILKCSVRRKKLMSKVKDHIEEALRPASRENINLG
DFVLTERPDGEKVPAFVVVIETPEQEKREGYVPLLVYFGNGRVGWRSWKEVYKTSLRID
PRLIGTCVWVEGAEAISQLEEQGVFSYIDEQELIKKCYDAWMEWPFSTAIVEDQEPTFG
ELFERESVFEFVSGFNKMMTGLEVVNRKWNTDLVTGEPIKRDALHMLMLVTTEIAEAAE
GVRKDLMDDHLPERKMEEVELADAIIRIMDYANVRGLDVAGAMIEKIEYNMTRADHKRE
ARLAEGGKKV"
gene complement(51372..52508)
/locus_tag="BN405_2-10_Ab1_orf_81"
/db_xref="GeneID:14296633"
CDS complement(51372..52508)
/locus_tag="BN405_2-10_Ab1_orf_81"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_096"
/codon_start=1
/transl_table=11
/product="Putative RNA ligase"
/protein_id="YP_007236902.1"
/db_xref="GI:431810014 GOA:K4RMD4 InterPro:IPR012646
InterPro:IPR021122 UniProtKB/TrEMBL:K4RMD4 GeneID:14296633"
/translation="MSNSQDRVLARVVRIDDVKTHPNADSLDLALVGGWQCVIKRGEYQ
AGDLAIYIEVDSMVPVDNPIFEFLRGRNMVERDGKEYSRIKTMKLRKELSQGLIVPVHS
AGSPELKVDEDVTDRMGILKYVKPSEQAAINGGNKGDRTGTSKLGFPNFIPKTDQTRVQ
NIKMAYDQAHQKGEKFEVTFKLDGSSLTIWHKDGEVGVASRNVGFRLEDEKIGFFTAVK
NFFKGRGWKRVIKKDSNHFTAMAEELDLGERLRYFGMNIALQGELVAPNIQGNFEGVDK
PEYYVYDIYNISDSRYCLPAERLAILNTLNQLGGETVKHVPVYMWDVGVPEDMQLVIKM
ASGESALNGKYREGLVFKSMSRDFSFKVISNEYLLKEE"
gene complement(52556..53017)
/locus_tag="BN405_2-10_Ab1_orf_82"
/db_xref="GeneID:14296634"
CDS complement(52556..53017)
/locus_tag="BN405_2-10_Ab1_orf_82"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp085"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236903.1"
/db_xref="GI:431810015 UniProtKB/TrEMBL:K4RLF7
GeneID:14296634"
/translation="MSFPLSGRRCPVLRFDSGCACSFPLHTLYCWPVSDVDISLQQVTH
FTTDYFLVKAIDTAEVSVQNTTTFNTTGGNTMKIDIRNEAAEVREIVFGDSVDCACRLE
KSEYTDVPVYIADGLPGNSGSWIPIRDLLDAENLLRALERAIDLGWFNK"
gene 53077..53496
/locus_tag="BN405_2-10_Ab1_orf_83"
/db_xref="GeneID:14296635"
CDS 53077..53496
/locus_tag="BN405_2-10_Ab1_orf_83"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp086"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236904.1"
/db_xref="GI:431810016 InterPro:IPR025475
UniProtKB/TrEMBL:K4RI33 GeneID:14296635"
/translation="MRARGRPEACLRRRIRMASLGTGLPPLPIYLHKEATMCAATVVNR
HYEKFDVYIGRGSKWGNPFSHKEGTKAIHKVDTVEQAIEGFRIQLWHNIQEGFITIDDL
LELDGKRLGCYCKPRPCHGDVLVRAIEWAKRQRGV"
gene 53499..53696
/locus_tag="BN405_2-10_Ab1_orf_84"
/db_xref="GeneID:14296636"
CDS 53499..53696
/locus_tag="BN405_2-10_Ab1_orf_84"
/inference="similar to DNA
sequence:INSDC:HQ832595:PaP1_gp080"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236905.1"
/db_xref="GI:431810017 UniProtKB/TrEMBL:K4RM51
GeneID:14296636"
/translation="MKHVIYREDLIDLLRDRMKLQALEAGGVDNWDWYEASLIDCGYFD
DDGRELEVEALADCFPTVGA"
gene 53672..53842
/locus_tag="BN405_2-10_Ab1_orf_85"
/db_xref="GeneID:14296637"
CDS 53672..53842
/locus_tag="BN405_2-10_Ab1_orf_85"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236906.1"
/db_xref="GI:431810018 UniProtKB/TrEMBL:K4RL11
GeneID:14296637"
/translation="MLPHRRCVVVEESKVTFKDPYPRFFDASRRYGETNDCMVVSFAVV
WNTTYERHTST"
gene 53839..54183
/locus_tag="BN405_2-10_Ab1_orf_86"
/db_xref="GeneID:14296638"
CDS 53839..54183
/locus_tag="BN405_2-10_Ab1_orf_86"
/inference="similar to DNA
sequence:INSDC:HQ832595:PaP1_gp081"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236907.1"
/db_xref="GI:431810019 UniProtKB/TrEMBL:K4RMD6
GeneID:14296638"
/translation="MKVKCKRGYRQGATQKRFSYADTWCPKTRMLYREDAKDKTLRQFA
EENPEGRFWIAVKGHAIAIIDGVLYDHTNDKRRTIWHCWQVWPGEAPEKIERKPDPISP
PVRKAPDWYV"
gene 54206..54460
/locus_tag="BN405_2-10_Ab1_orf_87"
/db_xref="GeneID:14296639"
CDS 54206..54460
/locus_tag="BN405_2-10_Ab1_orf_87"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp089"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236908.1"
/db_xref="GI:431810020 UniProtKB/TrEMBL:K4RLG1
GeneID:14296639"
/translation="MEIISRGTLPQEVLFTAKCHHCLSILRAKRSELEYVSFSFCRPGE
TGYYSAECPVCHEEVTAWVAVPVTHVAPPTTEYVAKGRE"
gene 54462..54851
/locus_tag="BN405_2-10_Ab1_orf_88"
/db_xref="GeneID:14296640"
CDS 54462..54851
/locus_tag="BN405_2-10_Ab1_orf_88"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp090"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236909.1"
/db_xref="GI:431810021 UniProtKB/TrEMBL:K4RI34
GeneID:14296640"
/translation="MDQLAGFMGEPFVIAFDYDETISLYPLAFRIVMDTFRGFGGAFNV
IVVTARHPDNSGELEWLRDYGFPIYFTAQKAKRPFMENLGIKVSVWVDDNPFSVDNDLP
PWTVEQYDAYMEAKKQRAINRGSKA"
gene 54848..55504
/locus_tag="BN405_2-10_Ab1_orf_89"
/db_xref="GeneID:14296641"
CDS 54848..55504
/locus_tag="BN405_2-10_Ab1_orf_89"
/inference="similar to DNA
sequence:INSDC:HQ832595:PaP1_gp083"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236910.1"
/db_xref="GI:431810022 UniProtKB/TrEMBL:K4RM52
GeneID:14296641"
/translation="MSEIMKVEVGDRVVLKAYCDTYTGCAKRWAQAHGRLDELLATGFV
EDSWVHCDDLAGGLKGTVVMTELEECCAVRLDAYTDHRAVVVVDSSDLYIACKAAKAPV
STLDEAFGCDHDYLMDSPANAQRLNESVEQLRTGQVVEVDVPMSVKQDETPPVVVHVVE
KIYDRKGNVHLILQYEVAGALIRTVVEQGELIYFLDEMQGMYLTKIQLEVNNGVV"
gene 55491..55658
/locus_tag="BN405_2-10_Ab1_orf_90"
/db_xref="GeneID:14296642"
CDS 55491..55658
/locus_tag="BN405_2-10_Ab1_orf_90"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp092"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236911.1"
/db_xref="GI:431810023 UniProtKB/TrEMBL:K4RL14
GeneID:14296642"
/translation="MELYDQWRKYMSVVILEEEDNERQCMRLIEAVGELDPYIQDFLDS
FSIKTEGGVV"
gene 55655..55951
/locus_tag="BN405_2-10_Ab1_orf_91"
/db_xref="GeneID:14296643"
CDS 55655..55951
/locus_tag="BN405_2-10_Ab1_orf_91"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp093"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236912.1"
/db_xref="GI:431810024 UniProtKB/TrEMBL:K4RMD8
GeneID:14296643"
/translation="MSMSGDSVIKAEGMESYFISHWDGWDSMDTACFGFYIKPEYVLDP
DIRKLEPSFLELDFERCRFTFWGNADEGLEGKLMEGKMHIMAPAFEYVFFKEV"
gene complement(56015..56344)
/locus_tag="BN405_2-10_Ab1_orf_92"
/db_xref="GeneID:14296644"
CDS complement(56015..56344)
/locus_tag="BN405_2-10_Ab1_orf_92"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_107"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236913.1"
/db_xref="GI:431810025 UniProtKB/TrEMBL:K4RLG3
GeneID:14296644"
/translation="MDHNFLVLPVSTVNPATHAHVVDAIGCHFDISCIVRPLYHKECGN
VKHPLHFDPMEPLHLGHKEVGIFLHFIIPSLKLHKANNLSIPAGCPIHIVGSRKLMEGA
FPTIL"
gene 56066..56374
/locus_tag="BN405_2-10_Ab1_orf_93"
/db_xref="GeneID:14296645"
CDS 56066..56374
/locus_tag="BN405_2-10_Ab1_orf_93"
/inference="similar to DNA
sequence:INSDC:HQ832595:PaP1_gp086"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236914.1"
/db_xref="GI:431810026 UniProtKB/TrEMBL:K4RI35
GeneID:14296645"
/translation="MDWAACRNGKVVSFVELKARNNEMQKYPDFFVSQMKWLHGIEMQR
VFDIPAFLVVKWTDYTGYVKMTANGVNYMSMGGRIDRGDWQDQEVMVHIPLKDFTRL"
gene 56808..57053
/locus_tag="BN405_2-10_Ab1_orf_94"
/db_xref="GeneID:14296646"
CDS 56808..57053
/locus_tag="BN405_2-10_Ab1_orf_94"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_108"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236915.1"
/db_xref="GI:431810027 UniProtKB/TrEMBL:K4RM54
GeneID:14296646"
/translation="MNGPECRWCGEKTEAEFVDVGFGWMQQVTGGMCHQCGGYENGHYQ
NDGRLSEVEFATYWSGPFEDYADFSPFNHMREGDSP"
gene 56981..57235
/locus_tag="BN405_2-10_Ab1_orf_95"
/db_xref="GeneID:14296647"
CDS 56981..57235
/locus_tag="BN405_2-10_Ab1_orf_95"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_109"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236916.1"
/db_xref="GI:431810028 UniProtKB/TrEMBL:K4RL18
GeneID:14296647"
/translation="MEWSVRRLCGFLAIQSYERRRLAMKATLRNHNLLYIYFHTFSEMN
EWLTENAVDQWTVTTLGSGYQVAVPMDRAMRDQYVSERG"
gene 57289..59151
/locus_tag="BN405_2-10_Ab1_orf_96"
/db_xref="GeneID:14296648"
CDS 57289..59151
/locus_tag="BN405_2-10_Ab1_orf_96"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_110"
/codon_start=1
/transl_table=11
/product="DNA primase/helicase"
/protein_id="YP_007236917.1"
/db_xref="GI:431810029 GOA:K4RME0 InterPro:IPR006171
UniProtKB/TrEMBL:K4RME0 GeneID:14296648"
/translation="MSKMTVAQIAAMHGIDLYSDHKTACPQCRKKGADNSGDNLKVYGT
DRNTGEHKGAYCWACGYTLLSEEQERDARGEDEEEWNFVGTEFNAEINAQIKEQCSYDP
RGYRGLSKETCQYFGVLHGFDPETGEIATQLYPTTTNYELTGYKQRIMPKNFSEPIGET
GKDCELFGQFRFKNSNSKKVLIVGGEVDQLSAFQMLKEYDDRRAGGKSDYEPTPVVSPT
IGESGAWKQLQAQYEWLDRFEQIILCFDSDDAGREAADKAADKLPKGKVFMMEMNRKDP
NEYLKAGRQSEFVSAFYRARTWTPSXIVGSDALDARMYEAVQVEKIPLPPFAKKLQKAM
AGGIPLGRIVNIGAASGMGKSTVVDEFTLFWIYNSPHMPGTVTLESDCGEYAIKLLSRK
VGEKADLYETVEEKVAFLDRHRDARYDLWHKEDGSPRFYLIDDRDGSLAALKAQIEQLI
IQFECRVIILDPLQDILDGLSNEEQSVFMRWQKGMTKSHRVTFININHVRKSGGGQKAN
SAGAELYEEDFQGSSSIFKSGAANILMWRNKDAENEFEKNLINVKLSKCRWTGRTGMMG
NWYYDVETHTIWDLDDYLDRYPDKRREYEAWMAQKEEEGRDTEY"
gene 59212..61926
/locus_tag="BN405_2-10_Ab1_orf_97"
/db_xref="GeneID:14296649"
CDS 59212..61926
/locus_tag="BN405_2-10_Ab1_orf_97"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_111"
/codon_start=1
/transl_table=11
/product="DNA polymerase"
/protein_id="YP_007236918.1"
/db_xref="GI:431810030 GOA:K4RLG5 InterPro:IPR001098
InterPro:IPR012337 UniProtKB/TrEMBL:K4RLG5 GeneID:14296649"
/translation="MQQRFETIEQYLEWMGNNNVTNMTWDIESTGLLDETSIDYTASPY
KIKPSYSHHCVVVEEHGGNILAFYDGPTYVFDGREYTEKLPKASSMLHTEEVVTLKDYT
PVEYIHLPLKEFKNYVLKRKIKRVVAHNMINFDLMSMKLVEDMDFTIGVEHRDGGLTTW
SADTWMGKQVVFDDTLVISKTCNPDLFGGHSLDKLSRRAGGDTKIDFRKHLAPDVRFLD
FAADMLYYCIYDVKANTAVWHWLQDHEDYQLSDRDNYIKNWLSPIQLEKKVAEIITYQE
HRGFVLNVDLCEKAVKDLDAKMEERRARVEPVLPPRPATKKFMADYTPPVRQFKKNGEI
TTYLQKFIEKIGAQLKEGDDRTMIFEGKEYKLPLPADVPLKTEMPAKIGDTTHIKQWLM
GEFGWIPSEWKETDLTVDQKKIKLPMENIVAKIDRWLDVTYSTAYKEERLDGFGDYMKI
TPRSTRAYVRQRLIDRASKGGCKVLTNPSFTKGQEKEMCPDLERIAEQFPFAKDVIEYL
TFKHRRSAILGGGMDWDEMEDGEEPEKGYLASIRQDGRIPTPADTCGAATSRMKHRKVA
NVPRITSLYGAELRELFGVGDGFFQIGYDFDSLEARKESAYCDQYDPTKEYCKSLMMEK
PFDVHTMMAKRISEIIGRQFNRSPAKNVKYGCTYGAQAGKVAKTIGADLQTGQLVFDAF
WDAAFPLKALKDDLTKQWEANGKKYIVGVDGRRVPTRSAHAILNSLFQSGGVICAKRAM
VIHDQLLEKEGLKVDFFKEDWKNKPEFCQQMIAYHDEAQLEVTAKSVSFKMFPWSLVGG
KPEGEKEREAAEKELKALAQAYKDEQLAATGKVWSDIAHYSKGEGGVFVAYCRAGELAT
KAVRAAGEFYSTPLVPIELTAGYIVGRSWKDCH"
gene 61800..62414
/locus_tag="BN405_2-10_Ab1_orf_98"
/db_xref="GeneID:14296650"
CDS 61800..62414
/locus_tag="BN405_2-10_Ab1_orf_98"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp099"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236919.1"
/db_xref="GI:431810031 UniProtKB/TrEMBL:K4RI36
GeneID:14296650"
/translation="MPCWRACHEGRESCGRVLLYSSGAYRADRWLHRWSILEGLPLKLA
LSEERGLTGPSASYTMATYSQHTRRNTMTLAFIIYLVMTVFPALSSAGSFALIVTIIAW
VAGGFVYLASIGGRENSAVKATLKNHLRPLTFKLFLPIIVIGHLVPSSETAWWMVGGYA
AQSLYQADATQQVLSESTELLEALVKRAKKETLKAVEGSSE"
gene 62443..62610
/locus_tag="BN405_2-10_Ab1_orf_99"
/db_xref="GeneID:14296651"
CDS 62443..62610
/locus_tag="BN405_2-10_Ab1_orf_99"
/inference="similar to DNA
sequence:INSDC:HQ832595:PaP1_gp092"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236920.1"
/db_xref="GI:431810032 UniProtKB/TrEMBL:K4RM55
GeneID:14296651"
/translation="MNTARLYVYGKSSMVGITVDNKANREYYTSKGFEVSETPLAHKSV
ANKYKQKGGK"
gene 62612..63322
/locus_tag="BN405_2-10_Ab1_orf_100"
/db_xref="GeneID:14296652"
CDS 62612..63322
/locus_tag="BN405_2-10_Ab1_orf_100"
/inference="similar to DNA
sequence:INSDC:HQ832595:PaP1_gp093"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236921.1"
/db_xref="GI:431810033 UniProtKB/TrEMBL:K4RL20
GeneID:14296652"
/translation="MSGVIPGTIVKLTQVGCDVTVGWPKEARYVGAYAVAVDGRDIGLP
EGEIRFCSLHWSIDRDVNDGLGDYQSMLADNDRFEIVAIPGKKYYVKSAAARPDLISHY
LVTSEPALYEGFEPCWLKSMHEGESPFCMLFKGRVNIGGDISDDPKLQTLYPELVLEEF
KEEAEEAIEAPVNEEKKEKVAKHAVMGYAVLDVDGFPLKFTITREEARSTKRWWGGKAE
GVSIVKLIKGEEVR"
gene 63379..64428
/locus_tag="BN405_2-10_Ab1_orf_101"
/db_xref="GeneID:14296506"
CDS 63379..64428
/locus_tag="BN405_2-10_Ab1_orf_101"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_114"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236922.1"
/db_xref="GI:431810034 UniProtKB/TrEMBL:K4RME1
GeneID:14296506"
/translation="MTHSPSLGYLNRRNKMAFKLNVTTNTQSGNGGIRKEVDWDALNNH
VVEAAGTAAKARSIPGYISGIIDLGEQEQNDAEVVFTGTAEDEIQIIKEYPNTYFKDGL
DKQTRKPVRLKCWPQRDMQQIAITVDFPQIEVDKSLYLTGNSNKSPLRVLYNGDFTLPG
QKTKIVGRPFTIKEVKHPNGKWAFAKNSMLHKLAVATGVINEDELFTKDRVGELLGKVA
QFQVRVWMKPGKNDMKFLTEDISLVGMVPEGVPVPELDEKYIYGVNLYGENDEEAVKQL
RANVINTIKRAKNYEGSDIKAMIEAVEAARGGNRSSGDSEEQAEAKEETKAAPKVEPVQ
TNVDDDIPF"
gene complement(63406..64503)
/locus_tag="BN405_2-10_Ab1_orf_102"
/db_xref="GeneID:14296507"
CDS complement(63406..64503)
/locus_tag="BN405_2-10_Ab1_orf_102"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp102"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236923.1"
/db_xref="GI:431810035 UniProtKB/TrEMBL:K4RLG8
GeneID:14296507"
/translation="MPPLKFEREGPKPLYYLYYLYFRVTLERNVVIDVGLNRLNFRSSF
GLLFSFSLFLAIPTGAVATTCSFNSFDHRLDIRTFVVLGSLDGVDDVGTQLLNCLFVVL
TIQVHAVDVLLIQFRDRNTFRHHTDQTDILGEEFHVVFARLHPHSNLELSHFTQKLAYA
VLGEEFVFVDDASSYSQFVQHGVLSERPFAVRVLHFLDGERTANNLSLLTRQSKVAVVQ
DTKRRLVAVTGQVQALVYLDLREVHSDRDLLHIALRPALQTYRLASLLVQSILEVSVRI
FLDDLDFIFGSASEHNLCIVLLLLAEVDDAGDITRDRTCFSGSSSSFHDVVVQSIPIDF
LADAAVAGLSVGSYVQFKSHFISPI"
gene 64509..64760
/locus_tag="BN405_2-10_Ab1_orf_103"
/db_xref="GeneID:14296508"
CDS 64509..64760
/locus_tag="BN405_2-10_Ab1_orf_103"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp104"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236924.1"
/db_xref="GI:431810036 UniProtKB/TrEMBL:K4RI37
GeneID:14296508"
/translation="MQINFGPIFLLAAIVLCVLKSAGVLAISWTVALMPIWIPLVIVLS
VLLLLLVVAGLIYAFGDRSQLNFAFKKNYSLKKNFRNK"
gene 64767..64991
/locus_tag="BN405_2-10_Ab1_orf_104"
/db_xref="GeneID:14296509"
CDS 64767..64991
/locus_tag="BN405_2-10_Ab1_orf_104"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp105"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236925.1"
/db_xref="GI:431810037 UniProtKB/TrEMBL:K4RM57
GeneID:14296509"
/translation="MMSNLVIVRVPEYILKGPAVQNQFSGEVWERELFKDLKEAAKSII
EGEPAYVALPNKVNPDTRQTEWDIKVVQF"
gene 65021..66085
/locus_tag="BN405_2-10_Ab1_orf_105"
/db_xref="GeneID:14296510"
CDS 65021..66085
/locus_tag="BN405_2-10_Ab1_orf_105"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_117"
/codon_start=1
/transl_table=11
/product="Putative exodeoxyribonuclease"
/protein_id="YP_007236926.1"
/db_xref="GI:431810038 UniProtKB/TrEMBL:K4RL23
GeneID:14296510"
/translation="MEIKMSEKEEDIVLIDGDLIAFKCASVNETRSIIVKNKLTGEEET
WKNRTTWRENNKDEEGFNEDNFEIEDHQDPKHVSYGISVVKTMIDRICRQAGCKQFKIL
LSGPDNFRDAIPLPKEYEITKGKKTFTRGGRYKGKRTGQIKPLQLGQLRQYMIEAYDTI
IHPGEADDLMAEMMYKNGVSYSRGETTQRVIGATIDKDADGTLGWLCNYEREPVQVKFI
SGLGSLYRDSKGKVRGEGRKFFYFQLLFGDPVDCYRPADLCVGKDFGEVAAFNIINPCT
TDKECWQAIYDTYKSWYPEPVTYTAWDDTEHTKDAIDIMQMYCDCAHMQRWAGDRVDCR
AVLAKLGVDLGGAE"
gene 66082..66645
/locus_tag="BN405_2-10_Ab1_orf_106"
/db_xref="GeneID:14296511"
CDS 66082..66645
/locus_tag="BN405_2-10_Ab1_orf_106"
/inference="similar to DNA
sequence:INSDC:HQ832595:PaP1_gp098"
/codon_start=1
/transl_table=11
/product="phage protein"
/protein_id="YP_007236927.1"
/db_xref="GI:431810039 UniProtKB/TrEMBL:K4RME2
GeneID:14296511"
/translation="MSVRARPWEDFPGIWKTEAAFLSWVRGGIRRYLWSKNPVKLEFAK
SRRIKIANTNEKSKLRNPTVWGYVCEQCGKETPQANVEIDHKTGEFSLKRVEDIQSFVE
GVVFVRMEDLAVLCKPCHEIKTYAERYGLTLEEADIVKQAIAIQKQKGYDKVFLQEVGI
KPASNAELRKEQIIGYLRSKKEGG"
gene 66642..67040
/locus_tag="BN405_2-10_Ab1_orf_107"
/db_xref="GeneID:14296512"
CDS 66642..67040
/locus_tag="BN405_2-10_Ab1_orf_107"
/inference="similar to DNA
sequence:INSDC:HQ832595:PaP1_gp099"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236928.1"
/db_xref="GI:431810040 UniProtKB/TrEMBL:K4RLH2
GeneID:14296512"
/translation="MNEDRVYIVVRDEAPEYMVPTLVAHSILGADMAMVLLGQDRAVPS
TDLPSRPYMHAAAKTAIKWVEWKQWSFRKIVVRVSDKEYNKIKQIPFVYEGYEKTICKG
EGSCLVVPPLSKEETPNVLKFAKLWRPM"
gene 67240..67701
/locus_tag="BN405_2-10_Ab1_orf_108"
/db_xref="GeneID:14296513"
CDS 67240..67701
/locus_tag="BN405_2-10_Ab1_orf_108"
/inference="similar to DNA
sequence:INSDC:HQ832595:PaP1_gp101"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236929.1"
/db_xref="GI:431810041 UniProtKB/TrEMBL:K4RI38
GeneID:14296513"
/translation="MSSYRRGAMTSLATYVIRHKKTKEIWTTPKGKRQWATKGAAALAW
RNAYEGTTLGVWAAKRDMERWSDLNIPMIVENGCYRLASREAAAFKSQSAFEIIDIAES
LKNENQLVLDLLKDVIGFEVPDSVGDGYVRLTIKTSTYDDIIKLLKETK"
gene 67698..67868
/locus_tag="BN405_2-10_Ab1_orf_109"
/db_xref="GeneID:14296514"
CDS 67698..67868
/locus_tag="BN405_2-10_Ab1_orf_109"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_122"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236930.1"
/db_xref="GI:431810042 UniProtKB/TrEMBL:K4RM58
GeneID:14296514"
/translation="MSMMDPKAYFIKQDLEEATKLLERAYNLLDNVHCYDTAVYEDIGA
FLYGQDCEEVE"
gene 68034..68828
/locus_tag="BN405_2-10_Ab1_orf_110"
/db_xref="GeneID:14296515"
CDS 68034..68828
/locus_tag="BN405_2-10_Ab1_orf_110"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp112; similar to
Pseudomonas phage PaP3 constituent protein (NP_775232) and
Pseudomonas phage LUZ24 hypothetical protein (YP_001671917)"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236931.1"
/db_xref="GI:431810043 GOA:K4RL25 InterPro:IPR004843
UniProtKB/TrEMBL:K4RL25 GeneID:14296515"
/translation="MGGGRMSSKKHFVISDTQCKPGISLDYMEAIGKYIVAKRPDVVIH
IGDHFDLASLSSYDKGKRSSEGRRYSEDVQVGREGLDRLFKPLWELQERQRANRKKVYQ
PRLIFTLGNHEERADRAANDNPELYGTVGSDELGIQDYGFEVVPFLKPIEVDGIYYVHY
LQNHFTGKPLGGTANNMLKAAGHSFVMGHRQLLDWAIHPTIDGKQRLGIVTGACYPHDE
AYKGYQGNNHFRGCVMIHEVKDGFGLPMPVSLDFMMEKGGFK"
gene 68738..69007
/locus_tag="BN405_2-10_Ab1_orf_111"
/db_xref="GeneID:14296517"
CDS 68738..69007
/locus_tag="BN405_2-10_Ab1_orf_111"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_125"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236932.1"
/db_xref="GI:431810044 UniProtKB/TrEMBL:K4RME3
GeneID:14296517"
/translation="MCYDSRSEGWFWSANASKSGLHDGERRFQMTVYKFWCEWDIGINE
CLWRDYYQMEEDVAKALSDCGIEDTIEELEGAGLLGFDSVKVIG"
gene 69247..69582
/locus_tag="BN405_2-10_Ab1_orf_112"
/db_xref="GeneID:14296518"
CDS 69247..69582
/locus_tag="BN405_2-10_Ab1_orf_112"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_127"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236933.1"
/db_xref="GI:431810045 UniProtKB/TrEMBL:K4RLH3
GeneID:14296518"
/translation="MTDFNITPEQMEEAMAGMNPEQRALVEKALTDRKSLEDSIVTEDG
ELDYGMLARHIRTSLGDLPLVMGGPDFLKLMILVAAMPETKDDLLTLHMNLSFILDCIR
ESISDEE"
gene 69631..69798
/locus_tag="BN405_2-10_Ab1_orf_113"
/db_xref="GeneID:14296519"
CDS 69631..69798
/locus_tag="BN405_2-10_Ab1_orf_113"
/inference="similar to DNA
sequence:INSDC:HQ832595:PaP1_gp108"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236934.1"
/db_xref="GI:431810046 UniProtKB/TrEMBL:K4RI39
GeneID:14296519"
/translation="MVDSAGLDALLAFLESQFKGPKGVLKGYVTMRVMCAKIESLDGFQ
ELKDMEVNFE"
gene 69791..70741
/locus_tag="BN405_2-10_Ab1_orf_114"
/db_xref="GeneID:14296520"
CDS 69791..70741
/locus_tag="BN405_2-10_Ab1_orf_114"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp116"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236935.1"
/db_xref="GI:431810047 UniProtKB/TrEMBL:K4RM60
GeneID:14296520"
/translation="MSNDIIDVHAGQPISLVQRSKNPINIQYWDADTIPYGTVLVVTEE
RGDIRKGELVVRLASSADDEHSVKVCRFSDFFLLMERGYNSASLSDVSQAYDVLFEDPP
ATTFVNWDRAQPLTNSERYYGDFLIGGDPKGMPLFNMAVLKNVLSPYTADDEELSAMSG
NPETVEHKEVDELSERDEALAEVDRLNEELVALGKKVVFANLEDYLGKENYATLEAMAN
HKEAVGSGGSSSYYTVKVNNPTTKANMPYFAECNDIIEALDMRFGQGNMFKALWRAAAA
QNLGKLKAGNDVIRDYEKVIFFAQLEIDKILRERG"
gene 70948..71913
/locus_tag="BN405_2-10_Ab1_orf_115"
/db_xref="GeneID:14296521"
CDS 70948..71913
/locus_tag="BN405_2-10_Ab1_orf_115"
/inference="similar to DNA
sequence:INSDC:HQ832595:PaP1_gp110"
/codon_start=1
/transl_table=11
/product="thymidylate synthase"
/protein_id="YP_007236936.1"
/db_xref="GI:431810048 GOA:K4RL29 InterPro:IPR003669
UniProtKB/TrEMBL:K4RL29 GeneID:14296521"
/translation="MQISAKVIQHSSRIGLGTKNHRFITTFELEYPRFIHSELMTHRLF
SRNAASSRAIPVAHMIRQVEENPAMPVHWGMNQPGMQAEFELSECLQRSSQYLWKKAAK
SAARIASALNKMGLHKQVVNRLLEPFQMMKTVVTATELDNFFYLRCHKDAQPEIKVLAE
KMYEALIKAGPAEALYDGEWHVPYVTRFRIGDGKLRYADCNGQELSVEDAIKVSASCCA
QVSYRKNDETLEKALVIYNRLVDTKPVHASPFEHQATPMLEPHFWCGDCQQQPDWEDGV
THADREGNFWSGNFKGFIQHRQLIKGHVCNEYYGREEEGV"
gene 71879..72259
/locus_tag="BN405_2-10_Ab1_orf_116"
/db_xref="GeneID:14296522"
CDS 71879..72259
/locus_tag="BN405_2-10_Ab1_orf_116"
/inference="similar to DNA
sequence:INSDC:HQ832595:PaP1_gp111"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236937.1"
/db_xref="GI:431810049 UniProtKB/TrEMBL:K4RME4
GeneID:14296522"
/translation="MSTTAEKRKEFKMAEYNLSLEDLMLVDGFKEAFQSNNEKIVREHL
WTNGMDVKNYSYEMVFCQHRTLIGRVVEGLRFSGFERTDKEWLSLGCASLEAHIAACDD
SNLRFTLRKMRPEGSTEATFHN"
gene 72174..73322
/locus_tag="BN405_2-10_Ab1_orf_117"
/db_xref="GeneID:14296523"
CDS 72174..73322
/locus_tag="BN405_2-10_Ab1_orf_117"
/inference="similar to DNA
sequence:INSDC:HQ832595:PaP1_gp112"
/codon_start=1
/transl_table=11
/product="ribonucleotide-diphosphate reductase beta subunit"
/protein_id="YP_007236938.1"
/db_xref="GI:431810050 GOA:K4RLH7 InterPro:IPR009078
InterPro:IPR012348 UniProtKB/TrEMBL:K4RLH7 GeneID:14296523"
/translation="MQRVMIVIYGSLFVRCDQRDRQRQRSTINAVGVDMEVTKALVDEA
DIFNKITQIRTPTESYARKYPVIVELANQQLEEKLWFSSEMKVELDKLNLKFKLEPHQL
HAVKTVLQLFLKYELIVGEEFWMGKVVRTFPRPEVKLAASILCMMELAVHAEFYNQINV
VLGMDTDADYVAYKDDPELMGRMDWLESVLGDEDDVLSVIIFSLTETALLFSSFAILKS
FQCNGYNDIPVIARGANQSAVDEDLHGVVSAEIINQYYAEIGRPLSEDTRRVEKIRQAI
DHVYAHECRIVDMAIPGGELNGESAENYKAFVRYRLNVWCRRLGLEDHFENDDTPIKDW
FEMNTYAYKMIDFFTPGMGMEYELGWDEEELAKAWEEELKYE"
gene 73315..75060
/locus_tag="BN405_2-10_Ab1_orf_118"
/db_xref="GeneID:14296524"
CDS 73315..75060
/locus_tag="BN405_2-10_Ab1_orf_118"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp120; similar to
Pseudomonas phage PA11 hypothetical protein ORF029
(YP_001294622) and Haemophilus parasuis SH0165
ribonucleotide-diphosphate reductase alpha subunit
(YP_002475870)"
/codon_start=1
/transl_table=11
/product="ribonucleoside-diphosphate reductase alpha chain"
/protein_id="YP_007236939.1"
/db_xref="GI:431810051 GOA:K4RI40 InterPro:IPR000788
InterPro:IPR013509 UniProtKB/TrEMBL:K4RI40 GeneID:14296524"
/translation="MSKRDTFNYSEARKNSQAAGETPLWYTTAGYQLFMKKYSNEGESV
RSRFETVARAMAQHAPKVYPEWWEKDEYTRGKDWEQVFFDVMWDGFVSPSTPLLSNGGL
RKKGTTVSCAGGLMDNNLYDRYNVMTEIAVLTKHSHGTSFSLTNWPSEGDAIRGGESQG
VMPVIRDVINVMEEVAQGSRRGSCAYSINPRHGDFWNVIDHLYKRTESNNVGWLLDDNW
CKAMAEKDPETLKRWKRMMFVKLARGKGYFTFIDKMNRHLAEPFKRAGLKVEASNLCQE
TVLPANDFYTFSCVILNYNLELYRSWPEHLVFIGQVMSDCNISEYLATMDEVSIQDRRA
LEKIYRFTKDFRALGSGVLGFHTLLQRERFPVGSMDAMFLNNAIFKGMKEQAEACNSWL
AEVLGEPEGCRGLGRRNATTMMMPPTKSTAELMAGASEGIGLDVAMCFTKQSAGGEFFR
VNKVLLEIIQERGLDWEECARQINERKGSVQHVDWLTDHEKAVFRTAFEVRMEDYLRLC
SQRQKYIDQGQSINLYFTSNDSPAYISYIHRLAMEDPNILSLYYIYSMRGAGDISRTEE
CEMCM"
gene 75164..75505
/locus_tag="BN405_2-10_Ab1_orf_119"
/db_xref="GeneID:14296525"
CDS 75164..75505
/locus_tag="BN405_2-10_Ab1_orf_119"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_134"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236940.1"
/db_xref="GI:431810052 UniProtKB/TrEMBL:K4RM62
GeneID:14296525"
/translation="MERSVLSYKYLDRYGMDCYNPSRLHWRDQPCMGCGVHAMNSKLRK
EFDKWWGQDEQEELRKSCAKGWAEYIWMASRRKVSVELPAPEGGFIDIQKYTINRCKEA
IRETGLEVF"
gene 75463..75738
/locus_tag="BN405_2-10_Ab1_orf_120"
/db_xref="GeneID:14296526"
CDS 75463..75738
/locus_tag="BN405_2-10_Ab1_orf_120"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_135"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236941.1"
/db_xref="GI:431810053 UniProtKB/TrEMBL:K4RL31
GeneID:14296526"
/translation="MQRSYPRNRTGGVLMKEYFKKRLMQTSEPFDSATQAMDVAIAWGG
AKYCEFTCVTADNRVISIWEYNDVEPDKPVFNGQQRILVPTFEEVV"
gene 75738..75974
/locus_tag="BN405_2-10_Ab1_orf_121"
/db_xref="GeneID:14296528"
CDS 75738..75974
/locus_tag="BN405_2-10_Ab1_orf_121"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_136"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236942.1"
/db_xref="GI:431810054 UniProtKB/TrEMBL:K4RME5
GeneID:14296528"
/translation="MEQTIDKSRYIVLDNEGRHVLTLCEKAAYNLLKGVQWTKDKHGQI
HVNGVTGVELGVRQGIIAEVFLYPGYIILEEVD"
gene 75974..76288
/locus_tag="BN405_2-10_Ab1_orf_122"
/db_xref="GeneID:14296529"
CDS 75974..76288
/locus_tag="BN405_2-10_Ab1_orf_122"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_137"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236943.1"
/db_xref="GI:431810055 UniProtKB/TrEMBL:K4RLH9
GeneID:14296529"
/translation="MDMFDKYMQVMYDRDAFSRRVGELEKEVAELKAKVAIAKCDMRVV
KTLLEDIQWVYQDEAIYTLPGYVCPCCGESANYGHFQGSFDKSPCLLACVLSRSEAYEA"
gene 76278..76463
/locus_tag="BN405_2-10_Ab1_orf_123"
/db_xref="GeneID:14296530"
CDS 76278..76463
/locus_tag="BN405_2-10_Ab1_orf_123"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp125"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236944.1"
/db_xref="GI:431810056 UniProtKB/TrEMBL:K4RI41
GeneID:14296530"
/translation="MKPNVVDSLGINMCYACGGKLYVRGVCTIYCPDCEKATKDKPFVR
MQLLQDIEDSKRVDNE"
gene 76372..76752
/locus_tag="BN405_2-10_Ab1_orf_124"
/db_xref="GeneID:14296531"
CDS 76372..76752
/locus_tag="BN405_2-10_Ab1_orf_124"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_138"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236945.1"
/db_xref="GI:431810057 UniProtKB/TrEMBL:K4RM63
GeneID:14296531"
/translation="MIARRQRKINRSSGCSFYRISKTARGLTTNRSASKMATSDRGGAM
ATTEKIIEYVSACIERLQEDVTGYSENFRDRALSNRTGYIHGLITMAEMNEQVSIEDCD
KLRAKLREAAEAVLNVLDSKIN"
gene 76761..77249
/locus_tag="BN405_2-10_Ab1_orf_125"
/db_xref="GeneID:14296532"
CDS 76761..77249
/locus_tag="BN405_2-10_Ab1_orf_125"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_139"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236946.1"
/db_xref="GI:431810058 UniProtKB/TrEMBL:K4RL34
GeneID:14296532"
/translation="MMNMKEIVQALIVVVALTLAAIGFVVGITALANKSAPAEDIVVST
EDGTINLGRSVKSEKLLYSMCIKVEDRKPACEFTTKDRVLSEVKQVMRPGEATARDIKI
AVNAAVTYTGENGQEATSLITPKGKYLPAGTPSEVHIQAIANLFDSVYNDYKQNFSKM"
gene 77259..77453
/locus_tag="BN405_2-10_Ab1_orf_126"
/db_xref="GeneID:14296533"
CDS 77259..77453
/locus_tag="BN405_2-10_Ab1_orf_126"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_140"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236947.1"
/db_xref="GI:431810059 UniProtKB/TrEMBL:K4RME6
GeneID:14296533"
/translation="MKAQPKEVETLSLDKRPKAGDVVRLRSDGKTYEVNAVYPTAVGWE
AILRNMYDKTKTVTVSMEW"
gene 77362..77694
/locus_tag="BN405_2-10_Ab1_orf_127"
/db_xref="GeneID:14296534"
CDS 77362..77694
/locus_tag="BN405_2-10_Ab1_orf_127"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_141"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236948.1"
/db_xref="GI:431810060 UniProtKB/TrEMBL:K4RLI2
GeneID:14296534"
/translation="MLYIPRQWAGKRFSATCTTRLRPSLSAWSGEMARTVKCVNFLPVT
PDGRVIVRFGKKRLGWLGKQGKKWHYYPYGCEGKIKSEGFKTLAEIKAWIRDPEAVWPG
PQPEID"
gene 77706..77957
/locus_tag="BN405_2-10_Ab1_orf_128"
/db_xref="GeneID:14296535"
CDS 77706..77957
/locus_tag="BN405_2-10_Ab1_orf_128"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_142"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236949.1"
/db_xref="GI:431810061 UniProtKB/TrEMBL:K4RI42
GeneID:14296535"
/translation="MVQWYVGNSLLNIRKLAMTSRWKEAVYRKYSVRRLRQELEEFKEA
RRFAPNQRIRAWFDAHIEFLERHLAIRESGQAYPDDLW"
gene 78125..79111
/locus_tag="BN405_2-10_Ab1_orf_129"
/db_xref="GeneID:14296536"
CDS 78125..79111
/locus_tag="BN405_2-10_Ab1_orf_129"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_143"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236950.1"
/db_xref="GI:431810062 UniProtKB/TrEMBL:K4RM65
GeneID:14296536"
/translation="MQFNISKQLWVAKSERKGDYKGTLLAYMSQVDFNKDGSLAASFKK
KQQTGMSWAGKNAETCFIDNIPISGHFIGDSVERWVTENKYFRVTDPRGFVLEVPTGNI
STLLYNCTVIKGVIQEPCVWVRMGSQHVLLPEGSSLYKEAVSFVERKEAAKTVKDMVAG
DRCTLLSYGTEEKLEAVYLGQVKITWHLLAKKGRYSSRGWGGGRWGYHHLERELDRKEF
TEKDSKWVSVFAKPVGKRWSIHFILSPKATDIQSGNVPDELQNLDLVNGVKWEYNEKDD
RPSSYYSVPDRVVKCISVDDPLWDKPHSSSEVRWTREWTVVGAEWRK"
gene 79334..79507
/locus_tag="BN405_2-10_Ab1_orf_130"
/db_xref="GeneID:14296537"
CDS 79334..79507
/locus_tag="BN405_2-10_Ab1_orf_130"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_144"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236951.1"
/db_xref="GI:431810063 UniProtKB/TrEMBL:K4RL38
GeneID:14296537"
/translation="MKIDNGSAYAYWLADMKEFVSQMDATEIEKRACIAYLISWYQRRV
LHRIKREEYEAI"
gene complement(79944..80108)
/locus_tag="BN405_2-10_Ab1_orf_131"
/db_xref="GeneID:14296539"
CDS complement(79944..80108)
/locus_tag="BN405_2-10_Ab1_orf_131"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_145"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236952.1"
/db_xref="GI:431810064 UniProtKB/TrEMBL:K4RME7
GeneID:14296539"
/translation="MLAHCAYIETACQPILCRFFSIFSLAFFSCLCIMTGRRATQAGGR
APEANTEGA"
gene 80070..80609
/locus_tag="BN405_2-10_Ab1_orf_132"
/db_xref="GeneID:14296540"
CDS 80070..80609
/locus_tag="BN405_2-10_Ab1_orf_132"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp133; similar to
Enterobacteria phage RB43 hypothetical protein RB43ORF003c
(YP_238979)"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236953.1"
/db_xref="GI:431810065 InterPro:IPR006640
UniProtKB/TrEMBL:K4RLI6 GeneID:14296540"
/translation="MTGCLYIGTMSQHSTERYSTMLHNDARELALQEMDKWGLLKQGWK
FRFNSKLKATLGRCHYTKKLIELGSDYVANNGLPAVLDTIRHEIAHAKAGRGQGHGAVW
KEWCELIGAKPNQYASTKEKVVVYPWRLAIHHGGGQLELLNHYGFRRTSMARKQVRGRP
ETLGRLVWVKNEDDRK"
gene 80691..80960
/locus_tag="BN405_2-10_Ab1_orf_133"
/db_xref="GeneID:14296541"
CDS 80691..80960
/locus_tag="BN405_2-10_Ab1_orf_133"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp134"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236954.1"
/db_xref="GI:431810066 UniProtKB/TrEMBL:K4RI43
GeneID:14296541"
/translation="MKALCNHRALYAAYNRSELDRIAVDLNRYFPIEKDDEWEDGAYMY
RRRTYLVKHSKGTARWHSLYCNGTVQGVGVIFDAKSDTRSFRTA"
gene 81116..81403
/locus_tag="BN405_2-10_Ab1_orf_134"
/db_xref="GeneID:14296542"
CDS 81116..81403
/locus_tag="BN405_2-10_Ab1_orf_134"
/inference="similar to DNA
sequence:INSDC:HQ832595:PaP1_gp129"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236955.1"
/db_xref="GI:431810067 UniProtKB/TrEMBL:K4RM67
GeneID:14296542"
/translation="MDSLSVKIVLSELSYKALIQAFALLGRTLDLDEGLDDILNLIADE
IAFRDGLPPFADDCDKTEWMLRRWESLPVVSYNIGQDGPIVARSIEVKTA"
gene 81413..81649
/locus_tag="BN405_2-10_Ab1_orf_135"
/db_xref="GeneID:14296543"
CDS 81413..81649
/locus_tag="BN405_2-10_Ab1_orf_135"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_149"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236956.1"
/db_xref="GI:431810068 UniProtKB/TrEMBL:K4RL40
GeneID:14296543"
/translation="MMTVRVGDIVAIRGDIRKKLDGTCQYTPEQLVGGKFLKHVGTGEI
WTGRVSKIQGDMAKVGGAWRGIEFYVLISEINA"
gene 81848..82156
/locus_tag="BN405_2-10_Ab1_orf_136"
/db_xref="GeneID:14296544"
CDS 81848..82156
/locus_tag="BN405_2-10_Ab1_orf_136"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_151"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236957.1"
/db_xref="GI:431810069 UniProtKB/TrEMBL:K4RME8
GeneID:14296544"
/translation="MAKSVSVDRKRSILDEAKDGSFFSVEFIKADGTVRKMTCKRQIKS
AYANGQFATRKPTSAGKPHLYTAAEVLNMEEGKSAFRTINLETLTRAKVNGIEYKFD"
gene 82614..82997
/locus_tag="BN405_2-10_Ab1_orf_137"
/db_xref="GeneID:14296545"
CDS 82614..82997
/locus_tag="BN405_2-10_Ab1_orf_137"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_153"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236958.1"
/db_xref="GI:431810070 UniProtKB/TrEMBL:K4RLI8
GeneID:14296545"
/translation="MARRQRLPSWVQDQTEDETPLRDRIDPYLSKLGEVDKLEGQLRRV
RDATDPDEYNEMAKVLKARRRKIMKQRARAYGLPEDEPTNVQGYSVPEEVHRRAILLSS
VKPWMFWTILSFSIFVWFVLKNS"
gene 83073..83744
/locus_tag="BN405_2-10_Ab1_orf_138"
/db_xref="GeneID:14296546"
CDS 83073..83744
/locus_tag="BN405_2-10_Ab1_orf_138"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_154"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236959.1"
/db_xref="GI:431810071 UniProtKB/TrEMBL:K4RI44
GeneID:14296546"
/translation="MHFVLNLVSKNSKTGPMPVSTSHNGTCPDACPLKAKGCYAAYGPT
AIHWKKLSKGERGVEWKEFLKQVRSISRGDLWRHNQAGDLVGQDDVIDGIALMELVKAN
KGRRGFTYTHYPMNNFMNRQHVLSANRSGFTINLSGNNVAHADELADLNIAPVVTILPM
DAENVSFTPKGRKVVACPAEKSDKVTCKSCGLCQVADREYIIGFRAHGTAKKTVDLIAK
G"
gene 83719..84087
/locus_tag="BN405_2-10_Ab1_orf_139"
/db_xref="GeneID:14296547"
CDS 83719..84087
/locus_tag="BN405_2-10_Ab1_orf_139"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_155"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236960.1"
/db_xref="GI:431810072 UniProtKB/TrEMBL:K4RM68
GeneID:14296547"
/translation="MSISLLRVNTMDESVYAPFNQCKMMGLERTVRSLAAPNGCKVVLY
QDHKNKHRIVIYDALGQGMSGVMVQADGEIHYKETRKASQGQNLTRQLQAQLTAWGVKW
FPSQYQTAAGAACYKGGE"
gene 84015..84440
/locus_tag="BN405_2-10_Ab1_orf_140"
/db_xref="GeneID:14296548"
CDS 84015..84440
/locus_tag="BN405_2-10_Ab1_orf_140"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp142"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236961.1"
/db_xref="GI:431810073 UniProtKB/TrEMBL:K4RL43
GeneID:14296548"
/translation="MGSEVVPLSVSDSGGRGLLQRRRVMRQLNKSQLKALGPKIDLALE
LASTGRGGLMNGHGSTCYIANKAGHNILRVSYHNSRFVAYGAESVRVTGNVIAAWVEWK
GINRAAINALSEYGYHPNLSIGHNDALKTLRDIERYQ"
gene 84583..84897
/locus_tag="BN405_2-10_Ab1_orf_141"
/db_xref="GeneID:14296550"
CDS 84583..84897
/locus_tag="BN405_2-10_Ab1_orf_141"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp144"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236962.1"
/db_xref="GI:431810074 UniProtKB/TrEMBL:K4RME9
GeneID:14296550"
/translation="MASAGLALHTERRQKIMLDSLGHSRRMAIKQDKPPIRRLKMKAVA
QFKSEDYASGDSRTATVYEDVYGCYIVSVFGTSLSEPIAFHWGPFEDKESASDAAKSTI"
gene 84916..85224
/locus_tag="BN405_2-10_Ab1_orf_142"
/db_xref="GeneID:14296551"
CDS 84916..85224
/locus_tag="BN405_2-10_Ab1_orf_142"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236963.1"
/db_xref="GI:431810075 UniProtKB/TrEMBL:K4RLJ1
GeneID:14296551"
/translation="MKISAILKNNLKFYKNNSFMCALAFDNVSRNKATEVQEFIHQLLG
PFVTLHAKLKKEIPGYERAVYDDEPEDEMTFFVSDRAYQMRRLWWETVIEQLEEQGQ"
gene 85221..85445
/locus_tag="BN405_2-10_Ab1_orf_143"
/db_xref="GeneID:14296552"
CDS 85221..85445
/locus_tag="BN405_2-10_Ab1_orf_143"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp146"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236964.1"
/db_xref="GI:431810076 UniProtKB/TrEMBL:K4RI45
GeneID:14296552"
/translation="MTQANWSKGVRVVGGKRDGEITLFTDAHFSESMGLCGGDPDLIEA
LPMPAALRLLVKWNKLCRQMKLDYRYELL"
gene 85478..85744
/locus_tag="BN405_2-10_Ab1_orf_144"
/db_xref="GeneID:14296553"
CDS 85478..85744
/locus_tag="BN405_2-10_Ab1_orf_144"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp147"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236965.1"
/db_xref="GI:431810077 UniProtKB/TrEMBL:K4RM70
GeneID:14296553"
/translation="MSILALTLTLCSAVQCDDYIIDHSLPGQAAECNARLVEEAEEWGD
AWVATNADARLTRYLSRFNIQVDPRFVFDYDFTCQLIAEDELP"
gene 85741..86133
/locus_tag="BN405_2-10_Ab1_orf_145"
/db_xref="GeneID:14296554"
CDS 85741..86133
/locus_tag="BN405_2-10_Ab1_orf_145"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp148"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236966.1"
/db_xref="GI:431810078 UniProtKB/TrEMBL:K4RL45
GeneID:14296554"
/translation="MNAPHLSLKQYRQRAAVIVRRVKYYERRWLRTVEFFSGAAAQNIA
ERFAYAGHAEEQMTKLKAEFAAFPVEVRLDALGWINWNTHNDGLLEEWIHQETDRAIMI
EYDETTWRPVACWETTVDALPKLAML"
gene 86248..86832
/locus_tag="BN405_2-10_Ab1_orf_146"
/db_xref="GeneID:14296555"
CDS 86248..86832
/locus_tag="BN405_2-10_Ab1_orf_146"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp149"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236967.1"
/db_xref="GI:431810079 UniProtKB/TrEMBL:K4RMF0
GeneID:14296555"
/translation="MLLVHGTTAKGLKAIMNRRGKEGLAAPWDVSDHDGMSYFYNVNKA
MEWHDEEEYAKAECIVRCLEQAQLQQAMMAEGGKIYALVVDIPEEFQDRVEDDYSCPNA
SNEASCFPEDNFDPSWIVEVYEAEVSVWAIPFIVAGVSGNSMFQSHQLPDKLVAIAESV
AQSSDIDTYEAFEIDHSQLPLSILEHFKDNA"
gene 86904..87149
/locus_tag="BN405_2-10_Ab1_orf_147"
/db_xref="GeneID:14296556"
CDS 86904..87149
/locus_tag="BN405_2-10_Ab1_orf_147"
/inference="similar to DNA
sequence:INSDC:HQ832595:PaP1_gp144"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236968.1"
/db_xref="GI:431810080 UniProtKB/TrEMBL:K4RLJ3
GeneID:14296556"
/translation="MAIVDRTAGNESPNHCYIVTGSIGPEFEPLLFTTKKLALQYAKQV
AGYGKANDVFPPFTPVIETRHKEDMHRFTIHNKIPE"
gene 87161..87490
/locus_tag="BN405_2-10_Ab1_orf_148"
/db_xref="GeneID:14296557"
CDS 87161..87490
/locus_tag="BN405_2-10_Ab1_orf_148"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_164"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236969.1"
/db_xref="GI:431810081 UniProtKB/TrEMBL:K4RI46
GeneID:14296557"
/translation="MKLSQILQAGLDYAIFRGSTWYMCVRLRELDLPVDLGGVLMDIQS
IMDEAGMIRDSSWDGGVDDYFWETGMADAYVMTVQEAVDYGSPAYAMWVQFWFFVIFDL
ARKGQ"
gene 87527..87970
/locus_tag="BN405_2-10_Ab1_orf_149"
/db_xref="GeneID:14296558"
CDS 87527..87970
/locus_tag="BN405_2-10_Ab1_orf_149"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp152"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236970.1"
/db_xref="GI:431810082 UniProtKB/TrEMBL:K4RM71
GeneID:14296558"
/translation="MGDKTVVYRVECMNGEGPYVNYGMEIDTSSTPERPVPEHDGIPDV
RHFEYFAFTSPSQLDDWFGDYYGQLTQYSSASIKMYEVDRQHVRTGLRQCVFRRDAAVC
VKEVTIAQWVGLLKAGMIAAVVTQALAPIPAEQLSLDLGLAGL"
gene 88094..88621
/locus_tag="BN405_2-10_Ab1_orf_150"
/db_xref="GeneID:14296559"
CDS 88094..88621
/locus_tag="BN405_2-10_Ab1_orf_150"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_167"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236971.1"
/db_xref="GI:431810083 UniProtKB/TrEMBL:K4RL49
GeneID:14296559"
/translation="MNKPMNTFAYAHYVARMDKASGTSLPYATLFRIALRNAYRKPGVR
QYDCAALVEDIKARELVQKRIRAEKAVVMAAVMRAIRTGFTVSVKDGSDGEWVVKKSTD
IKEISDSLQSTDEDIIRFRKGDGPDNIVGSMWAIYGNSAGEVIADWTDNATMAMIMAPA
ERKMEKYAELGI"
gene 88621..88902
/locus_tag="BN405_2-10_Ab1_orf_151"
/db_xref="GeneID:14296561"
CDS 88621..88902
/locus_tag="BN405_2-10_Ab1_orf_151"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_168"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236972.1"
/db_xref="GI:431810084 UniProtKB/TrEMBL:K4RMF1
GeneID:14296561"
/translation="MLDGARKGPHNAPIPANNIRTAPMSQIKIQEYIVAEIKVNHCAHL
RKGQTIQARDARSSEKWIAFMVERGYSASEAAILFKDAHDVAILELAA"
gene 88930..89100
/locus_tag="BN405_2-10_Ab1_orf_152"
/db_xref="GeneID:14296562"
CDS 88930..89100
/locus_tag="BN405_2-10_Ab1_orf_152"
/inference="similar to DNA
sequence:INSDC:HQ832595:PaP1_gp149"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236973.1"
/db_xref="GI:431810085 UniProtKB/TrEMBL:K4RLJ6
GeneID:14296562"
/translation="MKRQYTDSYQCKAIDGLMSICGGKKAIVQVWPSLKASRNRRLKKM
VKYIARSGWKP"
gene 89125..89607
/locus_tag="BN405_2-10_Ab1_orf_153"
/db_xref="GeneID:14296563"
CDS 89125..89607
/locus_tag="BN405_2-10_Ab1_orf_153"
/inference="similar to DNA
sequence:INSDC:HQ832595:PaP1_gp150"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236974.1"
/db_xref="GI:431810086 UniProtKB/TrEMBL:K4RI47
GeneID:14296563"
/translation="MPGLTIGDKSMNTLIIRLDSAYSVQTVRSFLMEAVESIRKHIRDY
AVHDEYDSGLSPVAPNHRLAIVTLDEDCRVFHIQCESPDLYLANPRIVFTDVESPAYTT
PVNEIEEYSYMTAWQHIRQKDMTAKDYLSDWSILFASKENAIDIDPRPNLKTQILH"
gene 89622..89852
/locus_tag="BN405_2-10_Ab1_orf_154"
/db_xref="GeneID:14296564"
CDS 89622..89852
/locus_tag="BN405_2-10_Ab1_orf_154"
/inference="similar to DNA
sequence:INSDC:HQ832595:PaP1_gp151"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236975.1"
/db_xref="GI:431810087 UniProtKB/TrEMBL:K4RM73
GeneID:14296564"
/translation="MKLRTIFETYDCRVRFVTITGVFVESQIVRSFGQAQEIVSLLCNP
ADTGIRLSFFDEEEGCESILCRFNYKGEIIK"
gene 89747..90139
/locus_tag="BN405_2-10_Ab1_orf_155"
/db_xref="GeneID:14296565"
CDS 89747..90139
/locus_tag="BN405_2-10_Ab1_orf_155"
/inference="similar to DNA sequence:INSDC:GU988610:PJG4_170"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236976.1"
/db_xref="GI:431810088 UniProtKB/TrEMBL:K4RL50
GeneID:14296565"
/translation="MQSRRYWYPSILLRRRGGLRVDPLPIQLQRRNHQMNNKYKDNIIA
EYCHFDGRRPVLSLAARWVHHDSRVVKLAALFACAGYGRPYKDCIKAYKDAKQREKDMR
NPAKWKLSRATKRALRARLVAIEKLE"
gene 90235..90501
/locus_tag="BN405_2-10_Ab1_orf_156"
/db_xref="GeneID:14296566"
CDS 90235..90501
/locus_tag="BN405_2-10_Ab1_orf_156"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp157"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236977.1"
/db_xref="GI:431810089 UniProtKB/TrEMBL:K4RMF2
GeneID:14296566"
/translation="MAKANLKFSRIGNDGYDYARREDGVWFVREGYYGRYGWAKTKWTQ
VQPGDGMTIVNACLKAHEAGSSSTYIGFGNLVVFSDGKGLRLP"
gene 90601..90795
/locus_tag="BN405_2-10_Ab1_orf_157"
/db_xref="GeneID:14296567"
CDS 90601..90795
/locus_tag="BN405_2-10_Ab1_orf_157"
/inference="similar to DNA
sequence:INSDC:NC_015294:PsPhPAKP1_gp158; similar to
Pseudomonas phage LMA2 hypothetical protein (YP_002154235)"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236978.1"
/db_xref="GI:431810090 UniProtKB/TrEMBL:K4RLJ8
GeneID:14296567"
/translation="MQATYQALKTLRDACEAVKDEKGTINGNKLNALRNKAVKEMQAGG
ETYSDAISMAHDLIKKYRK"
gene 91956..92549
/locus_tag="BN405_2-10_Ab1_orf_158"
/db_xref="GeneID:14296568"
CDS 91956..92549
/locus_tag="BN405_2-10_Ab1_orf_158"
/inference="similar to DNA
sequence:INSDC:HQ832595:PaP1_gp157"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007236979.1"
/db_xref="GI:431810091 UniProtKB/TrEMBL:K4RM93
GeneID:14296568"
/translation="MTSNIHAKMHIHYAKQIYYAMRKRAIASDEICKEWAKPKTGFEAF
YDWVVNVSGYAVGYRLDRNILFPGNKLYAPHTCEFSPTYIHTLFTNCDKTSNNRANNDL
PLGVRLARFDRWRLPVYVSQCRTLGKQTTLGSFDDPMAAHVAWQHAKMESILECIDLYQ
MEDVHSVDVVQALLDRVDKLDKDIAQGRETILLQ"
BASE COUNT 24603 a 22618 c 23100 g 22454 t 2 other
ORIGIN
1 agcgacagct tacatccgct ctcattttgc aatgagaatt gcgtacagtt catcatgcgc
61 ctcagaagtg acttcacttt gcatgcggat gcatgctata gtataccctg tgatagctcc
121 gctatcccgt tttgcatggc acacgaattg cataagcatg acaagggtaa ccctcgaaag
181 cggagctttc aaagtgtagg ctctacctct attatatttg cgaccggaag tagtgacact
241 gaaaacattg actccagccc agcaaatacg ttaaactaca aggtggatag ctgccgctat
301 caatagatca aaattcacac aaggagaccc aatgacaagc aacattcatg ccaagatgca
361 cattcattac gctaagcaaa tctattacgc tatgcgtaaa cgtgccatcg caagcgatga
421 gatatgcaag gaatgggcca agcccaagac gggctttgaa gcgttctatg attgggtggt
481 gaatgtgtca gggtacgccg taggctaccg cctagacagg aatattctct tcccgggaaa
541 caagctctat gctccgcata catgcgagtt ctcgcctaca tacattcata ccctcttcac
601 caactgcgac aagacaagca ataaccgtgc caacaatgat ctacctctag gcgtccgcct
661 agcaaggttt gaccgatgga gactgcctgt atacgtctca cagtgtagaa cgctagggaa
721 gcaaaccaca ctaggatcgt tcgacgatcc aatggcagcg catgtggcat ggcaacatgc
781 caagatggaa tccatcctcg aatgtatcga tctctatcag atggaagacg ttcacagtgt
841 agacgttgtt caagctctgc ttgatagagt ggacaaactt gacaaggata ttgcacaagg
901 tagggaaacc attttgttgc agtagtctcc catggcccaa cggctacccg tctagagtgc
961 gagtaatccg atagcgaagc tatcaatcgt atatgcatat tccatgccaa catgcggaaa
1021 gattttaccg ggcagggcgg gagcccgttg gcattagttt tgcatagctt agctgtcgct
1081 aagaaggaaa gaccacggcc acccattatt ttgggattac gtgaggttag gtatgcctag
1141 tgggttcgtg gttaagtagc tcggaaatag aaccacaact cccgaacagg atacactcgg
1201 acgtagggcc acactacatc attattttcc cagccataga gtaaacgcac tcttcaagtg
1261 gtcattattt ctgggagggg attggggtcg tgcatacaat agcaagctcc gcttgcacag
1321 ggagaatggc caatgcaaat ctataggatt ggtattggga ataagctgac aacagctaga
1381 ccgtaactgt gtaaaagaga gccccgggca gcaaaagctg cccggggctt tttgtctcta
1441 ctgattgtat tccatgtcct ctgcttccaa gcatccctgc ataaccttgc agtactcttc
1501 gttaatctgg tccatgtact gcaacgctcg ttctttgctc tggtcaggac tgaacccgtt
1561 gtgacggaga atcttgttca aattctcatc atcccagaag tctctggacc aagcctccca
1621 agccactgct ttcagactct ttatgcaccc gatccgggct ggataccaat actgctcaga
1681 cattagaccc tccaaacgca gcaaacaccc cttgcttagc taggatagtc tttagctcct
1741 ccagtgaaat ggtctcgtct cctacgacca catacttgtc tgccttccct agagtcatca
1801 cacacttagt ctggaaggta ggccgataca agtcatacac atcgggttgc cacttgcttc
1861 gcaggccagt tccgtagcta atgaaccggt cttcgggatg atcccggatg tataggcacc
1921 ggggactatc atctggccca tctacggaga tagggtgttc catccactcc ctgatcttat
1981 caacgacgcc ctctcctacc ttcaattgag cgtactgaca gtactcaagg aacgcatcaa
2041 actgttcggc agtgaaattg ctgacatcga tctctttagt tttcattctc ttcctccatg
2101 tctgcaatga tttccttcaa cgcttgaagc gtgtaggtgc catttagctc tgtagtagga
2161 ccagtgtcac actcatgaag cgtgtacgcg gtcactttct tctcagtgac gaaatggaag
2221 tctacccttc ggaagtcgta ggtcgatttc gagtatccaa tggccccttt gagttcttcc
2281 tcgtaccaca ggaatgtcat tggacttccg tcgcttttac gagtgtagtc cagcagatta
2341 tctccaaccc acagtagcac ttgagccttg tcgtacatga agccgtttcc gctcccaaac
2401 tcgataccat aagccttaag gtgctgttgt actgcaatgt tctcttcggg ggtcttcaca
2461 atagtgtaaa acttcaccaa acgctctttc aatttcattc ctcctgtctg tgttttatgg
2521 gagtgtaaaa cgttcccagt ccattgtcaa gctctctgtg gggatagacc gttccagacg
2581 ctctctagcc tcttttagaa tgatatccca ctcatcgcct tcttggactc ctacatactt
2641 ctccatcatc aacgcacggt caatcagacc agccttgtag ttatcccggc tacgcttgcg
2701 ggctaccagc ttgtcgatgt agtccttctt atctgccaaa gcggcgatag ccttcctagc
2761 cataagagca gcgtattctt tttcctccga agtcatccac ggcatattgg tcagtacgag
2821 gtcagcggcg tccctgacca aggggatatc tctccatagg aatcctaccg gtctcaggtc
2881 tgagtctgcg gtagctctcc actgtagcac tgttccggtc ttagaatctg taatatgcac
2941 cttctcatcg atacggtggg ccatcataga aaatctccag ttgcggtcta cgatccatcg
3001 cttccagtcg aagaatgtag cacaaatagc cttaaccggg tctccgacct tagcatccag
3061 ttccttcaga cgtttaatct gcttagcgtt tatatacttt acaggccggg aggctggatc
3121 atagcactcc tctacctgaa actcctcagc ccgagactcc aacactttag gctcatcgtt
3181 actttcttcc tctcggaacc atgcgaacag cttcttaaac atattcagtc ctcctctcct
3241 gtgatagcta ccctagtcag tctccacact tttctaggga gactaacgag gaatagcata
3301 gccataaacg gtacggcgat aggccagaat attccagcta acaccgctcg ggcctctttc
3361 ttacgcctct ccgtactttc tcccctccac ccaagaaggg gtcgtagaga ttcccatacg
3421 aacatcccta tcacagagta gaacaataga cagaccactc cgacgattat gcatacgaga
3481 atgagaagcc ctacttgttc catggtgcga tcctcttcag tagtttacga ctcctccaga
3541 tagacagaac ccacttaggc aacagcacca ctctcaagac gctatatgat gcatatatca
3601 gtataaagct agcgtacact gtgaatgtaa taggccatag cagtcctagt acaatggcga
3661 aagcctcgat accatctctg tgatctttag tctcacgagt caggaagtta ttttcgaaat
3721 actccttgat gcccatgtag gtccacatga atgcgattcc ccacgccagt gagaggatga
3781 acagtgccgg gattatctcc attactcacc tcctttgcga atcaaatcga agtaggccca
3841 cacgtagaag ttgcaccacg ctctgcctat ggcccagcct tcccaatagt cttcccagtc
3901 cttgttcgga gggttgttct cgaacatgga taacacgcag gaatcagcta cttcgtccaa
3961 gagacgcatt accgaattaa gcggcccgat tccaaaggtc ttatctagcc atcccttaaa
4021 tcgtcccacg tctgagacgg tgacgctgga gtcactgcac agtgccaatc tctccagaat
4081 gtagcacatg taaggctctt cttcgttctc taagaatgcc cgcatgccct ccttgattag
4141 cggtgcaata gaattagagt tcattgtttt cctcctttcg aatcaggtcg aaataagacc
4201 agacataaaa gttcacccag tttagatcag tgcctttcat gcaattacga tgaagataag
4261 aggtaactga ctcccacgac ggaatcccgt gctcctctat tagccatatt ctgaataacc
4321 gatactcttc tagagtgatt tgtccttctt ctgttaggtc gcttaggata taacacatat
4381 acgtgtccct gccgtttacc aagtagtctt ccagtccgat ctttatcaac tctgcaactg
4441 atctcattgt ttcctcctct gagagcccca ctagggctct aaatttttgg ttcgacctcc
4501 ggtcaacaca tcacaaccca gttgtacagg tcggcctcct cataagctga tgggtaacga
4561 ttgtactcca agaggaatgc gtagtcaata gctgcgtatt tggttgcgaa gctgccgaag
4621 tacgttataa atccgttatc gcctcgcctg aacagaacgt attcttcagt gccgtccttg
4681 aacgtatcca atgagatagt atacttgtcg aagatcacag catttcctcc cggctgatgt
4741 agtaattgta ttcgtcctct tggacgagga atgcccggta gaaacctttc tcgaagtccc
4801 cttttactag caccagattg ccctccactt tacaggtgta gatgtacatg gtgtttgcta
4861 ctcggataac tggatcatcc ccgggacgaa catccagagc agagagcata gcctccattg
4921 gcatgcttgt caagtgtgca actacagccg agcagtattc tgcatcgcgg ccagaagtgt
4981 cctctgcata agcaggagcg accccgcacg aatgcagggc gagtgtaaac gcaatagcta
5041 cgagtttctt gaacatacta accctcctct tggtctgtct ggggaacatc cggctttggg
5101 tagacgaatg tctctggata cttcatgcat cttagctcat ctttgcagaa cccgtcaatc
5161 aatttctcat gtgcgaattc cgcagccttg tagtagcgat tagcctgtct tgcctccact
5221 cgaaggaggt ggcttatcgt gtgagcgttg atattactaa gacttgcaaa aattgtcaag
5281 agcttttttg cagaaagagg aatcgacctt tcatcgggtc tgtaccagtc cagccgggca
5341 actccttgga gaacgtcgtc tacccacaac gggtagtctc cgtctagctc gaccatgact
5401 tcgtacattt caggctgaac agcgttgaaa aagaaagagg gctttcgccc tctgctggta
5461 tctagaggag gaacaagccc cctctccacc ttgtgaatca accgatcagc attcgcccct
5521 atccgagact ttagctcctc gatctcttca catgtcaaca tacggagggc acaccttaga
5581 tttctcgata gtgaacacgc cttcgcatgt caggttagca ggtccatacc acttgaacat
5641 gttgttgata tcgtatcgaa tcaactggcg gaacttctgc ccgtcgcaca tatcaacgtc
5701 gaaccacgca atagcccatc taacgtgctc ttcagggtcg ttctcttctc gccatctgca
5761 ctctagatca acgtggctag gctctagaac gtaaatgtct tcgaaccctg tgctctggtt
5821 gttcttaagt cggatgattc gagcgcgaat ccattgcatg cacctgcggt ttgggtctgt
5881 gatatcgcag actaccggaa cctctggaac ctcaactgta tacatgactg tacctctatt
5941 tgttttacaa gaacgccatg attctgtctc tatctgcatg gcggtacaga ttgaagcaag
6001 gcacgcctct agaggacgcc agttgccaag cggtcctagt cccgccttct ggaatcccgt
6061 tgtggtctgt cttgctccag cacaccaaga acttgctagg cgtgttgaga tcgattccca
6121 gcacttggaa aacgttccga gtgtgggctc gtcttgcgaa cgggcttaga acggacctcc
6181 cgtcatttct gacagagttc caagccggat gaatttgact ggcaatgcct ttagcttctt
6241 cccattcagc cggcaactct tcctctggca ggatggtggc tccgagcgtc tccgttatct
6301 ggtactggtt gaagccggga gacggaagat agatttctgc cgtagtccct cctttgttat
6361 tggatatata atccagccag cctgcctcga acgctgaatc cgctcccttc gctcctcctg
6421 accgaagaat aaaaccttgt tctgccagtt tacggcctac ctctcgaagg atgccccatt
6481 ctctgttcgg agtgtccctg cttccgactc ctgtataata tctcatcgtc tcaccatttg
6541 tcccagttct ccgtatgtaa tccagtggtg acgataatcc ccttcttggt tggtgtactc
6601 cactaacacc ggatagaagt tgtctgcgtg gtctatgttt accaccttgc attcacatcc
6661 tctgggaata gtgtatccat cgctgctcat ggttaagagc attccccggt acacgtcttt
6721 tatctctagc tcaccttctc cagactcttc aaacttgagt ctcaatttct cgattatttg
6781 agcttgcaaa tagagaagtt cgtacgctgt taggttgtcc agatcaatag acatgtcact
6841 ctctcccttc tagtttcttg aatgccttgt ccagcttggc tagatgctta tccaacttgt
6901 ctagcttttt atcctgataa agctggaacg cctccgagcc cggggccaac caagtcccct
6961 tatacttaat tgcaccccgg atcatatctc ctcctattac agttcgtaaa cgtacacttg
7021 gaactggccc agtgtctcct cgataagagg ctcgacattg ctccagtcct ctccggctaa
7081 accgcatcca atcttcggca gacctacaca caactccgag gtaggaatcg cccgagcgtc
7141 agcctctgcc tcaaggaaca gagacatagt gtacaaggct tggcccagtg cgtcaagctg
7201 agtgtagact cgaccctctt ctcggccata gttgtactgt ccgtacagat tataaatcga
7261 tccgtactcg ttcattgtga aggtgaggga gccgagcttt gctcggtccc ctttctccgt
7321 agctaggtcc gcctcgtaag cttccgggaa ttgctcccgg atttgcttag caatgccgct
7381 gcccatggtg ttgaagcaat tagcctgatg tgcaatagcg tgcaactctt tgtttttgaa
7441 cgctgcgata agatcgccct ttcggtattt aatcatttga acctctctac acttgtgtat
7501 ctgatattca aaccttccgc atcagctctg atcttatcgt acatcaagtc taatgctgcg
7561 aatggagacc agtacccttt ctcccagatt ttaaacttga acaatctatg tcctttattc
7621 tctggtcggc cttgctcaca gaaggttgta aaataatatt tagccaacat cctcgcctcc
7681 ttacacgccg ttcttaatcc gataacggat ggattccaga tcattgttct tcaaatcttc
7741 cgtgtcccac ttaccgtctt tgaagaacgt ccgcagatgc ccggtagctt cctcttcctt
7801 cgacacatca tccttcagtc ggaggaaccg tccattgtct tggtcccggt acactttcaa
7861 gagaccttta gccgacttct tcttgctatc agtcttgggg tctttgaaga ttgcaatgcc
7921 ttctccattc acctcggtgt aggtggcctt cactgcgaac ccgaaggtgt ctcgggtatt
7981 gcactgatag gtgtaactcc caactccgaa gaccacgttc aaggatgcga aacctttctc
8041 cttgagccgc tccaagattt tggctgcccg acgtgtggtg atcgaatccc catagatcaa
8101 accgatatga gaatccagca tcttataacc agcttcgttt acagtaccac cgaaggtttc
8161 ccaaagaact tggatagcac ctttcacctg agcctcgcta acttcctcta gtttatagcc
8221 aactacatac tcgtactggt cccactcggt tggaatgacc ttgaaatatt tatcttcgaa
8281 ctctagaaca aaagcgtcat ttccgttgac cgcatccatg atatcccagt gctcaagaga
8341 ttcaacaact tccacatcgc ccagtccgca gataacctct acaggatcgc cagaatcggg
8401 acgaacaacc agctttccgt cacgttccat gatctgatcc ttgatggacg gcagaatgtc
8461 agtaagcacg ccccagaagt cgaagctgtc tgccacgtaa gacagaatac cactcgggaa
8521 cttacccatc aggtcaacaa ggaatcgacg ttctgcttcc tcacggccac ctttaccttc
8581 tccatccttc atttctttct caatgcggag gatgttacta gtagctacag cgtgttcagt
8641 cgcaggaacg gagcaagcta ccaaaccagt cgcgttatag tagtcctcag cataaatagc
8701 tgctgccaat gtgtccgaac ctacgaacga ggtcaagtga ccaacaccac tacgggctgc
8761 gtcttcgatc ccgctcatgc cccgggcact gaagtcgtgg aactgaacag acagcaggaa
8821 gtcgtcatag catccagtgt gattcgcgta gtatcggccc atagctgcgt attctgcggc
8881 gatagtggcg ttagttgcgg tcttccaagt catagcagaa atcagtgttt cgtggtagtt
8941 cnccagccag taaaactcag gcagggtgtt cttgatggtg agaacaggca cacccatcgg
9001 cacactgacg ccttcggtaa gagattttac ctccagaggc agataaccga gcttgtggag
9061 ggctcgaagc tgctctacag cttccatctc acggccaaag taaccagtca ggaaccgggc
9121 ataccggcca actgcgttct cttcgtcagc cttgaagaag ccttcccaag actcgacgat
9181 ctccatccaa gcagcccgcc cgccgaccca cttaagagtg ccgtcgtaga agtcggtggc
9241 gtgagtctta cgataaattt tgtcggaacg aggagtcagg ttgctgtaga cgagctgagt
9301 tccttccgag tacatcgagc cgtgcccaat cttatagcca tcggtggaca ggtgcggcag
9361 aattttcata ttatttcctc ctgttgtgtt gaatgggccc agattatatc aatctgggcc
9421 ttatgtcaat actcaatttc ttctactggt agtgtcagta cagggtagac gcatggaaga
9481 cgcagtaatg gttgcttctt gctatgaaag tcttcccaga acttctcatg caacaccttg
9541 tacctagcgt ccagttcttc cttggtatcg aactcctcta ccttgacaac cctcttctct
9601 ggagacgagc gcttatactc cacaatccat atactcaagc tcatagcttc tcagccctag
9661 agtattcgac aggaacaacc attagctccg ggtggttctc ttgagggagg gtatcagatg
9721 tgtatatgca cccgaagtcg tccagtagac aatcaacacc cttgctgaag attccgtggg
9781 taacgaacag atcaggcaac acttcactgt accctctaag agctttagct acgctacgga
9841 atgtagcgcc tccgtcacag atatcgtcca gaacaagtag cgggagttca ggattgatat
9901 ccgaaggatt cagaatttca aagccttcga ttttgccagt ctggaggtct cgcttcttat
9961 tgcaacggat gatgactctg gctccagttt cctttgcaaa ttgttcagtc cttttagtag
10021 ctccgatatc tggggccaca atctggtact gttcccaatc tgaccgattc aacaacccac
10081 cgaatacaga tgactgagac acaacctcta cattattgat taggtgcaga gtggcctcac
10141 tgtgagggtc cacaacgatg acccgatcat acccagccga gttaatcaga ttggcgaaca
10201 ctttcaggct aaatgcgtcc ccgggattgc atcgacggtc ttgtcgggca tacgggacat
10261 atcccaaaag aagagtcatg tgtggtcggc ccattgccgc tcgaatagcc tcagtgacat
10321 tgagaagtgc catgatatcg tcactgttct gaatctgagc tttaacgttc acaaaagacc
10381 ctccactggc atcaattcca cttacattga cacccacctc accgcccggg aatgtccaga
10441 cctttgcctc cttcatagga agtgcaaaac ccggttcttc gatagtagca aggtaacctg
10501 ttacgtagct aatcatatgt cctccttata gcttcacaga gaagcgattc cgcattgctt
10561 ccatggtgct ctcaggcacg tcgtgtacag acttgttccc gtggcgattc tctacaatca
10621 gagagataac agtgtagcca aattcctcag ccatgtcaat gtaaggcttg atctcccgtt
10681 cccgagtact cgtattggac acgatcacgg cctctagtcc tacctccata gaactccgag
10741 ctttggccat acactttttg tgggattcag ccaccctctc agctttccac acatattttc
10801 cgaactccat ttggtagtca tctgcttcac agatagacgc cagcccgccc gatttccaag
10861 tcttgttata caggttctcg gcaaaggagg acttcccgga gcccgggagt cctcgaatga
10921 tgtacagaat cttctccttc atatctcctc ctttagattc gagccatatc gaagtaggtc
10981 tcgatcagaa gacgacgctg tgcgtcagtc atttctgtaa accggacttc ctccacttca
11041 tttaccaaga agtctaccag agggtagaac tcttcgtcaa gcgtctgctt gaatccagcc
11101 gggtcttgat acatcgaatt gaccttcttg ctacccatcc tcatgataaa cttcttgccg
11161 aggtagtgag tggacttgca cttaacagtg cctagccctg tttgtaccat gtaaccttct
11221 ttctcacaag aactcagaag accctttgca tgttcccagc tacactctat gtgctctgga
11281 cgaagaatct ttacagaact gtggtccgtt acacctaggg cgtgagagtc aagaatatat
11341 tctgaaagct ggcccccagt gaagatatcg cggataccga tcaaatatgc cccttcttct
11401 tcctcgacaa tgtgagggtc gtctggagag catatctcga agttatatgt gaagcctgcg
11461 atgtaatcat ctgggttatt cgacacatac ttctgaccaa gggcaacgta atcgctggtc
11521 aatgaccccg tagtactgaa gataagggag ccattgtgct tagtcacgga gaacatgaat
11581 ccattcactt tctcaatcag ccgcacacgg aatttaggat ggaggaaact cccagcacca
11641 ttctctccca gattaaacac cttctcgaag gggcgtacaa tacaatcacc ggagtgctgg
11701 tcaaatacat gaccccgtgc ctccagaagg agcggatgct cattccacag gttctcgtag
11761 aacaccttcc gggcatactt tataatcgac ataccgttga agtgcttaac agtcaccagc
11821 ttattagcga tcaggtcttt gtacattgca atgttgagat taccttccat cctacttctc
11881 cttatttcaa ttcgacaatt gggcagaatt tagccttctt tgcctttaga tacgatacca
11941 gaatcccatc cttgctggac gatttacttg acataaagcg agagaatcgg tagaaaaccc
12001 acacgccata aaagacggcg atgattccaa tccatacaaa ccccatgaca gccagagtcc
12061 cacctagaac atatccggta agtggaccga gagccagaga atacaataca gagcctacaa
12121 cagcagcgag cgctacaacc gttaacgcca gccacacgac gaggaatact gtctgccaga
12181 aataagagca gagggttaca atttgccaac cgcttgagat agccgaatag accggggtct
12241 cgaacgtacg atggagccgc atatgccacg aattcttatc aatcttcatg cttgttcctc
12301 cgggaagatg ttgaagttaa gtacgttatg ctcttcaagt tccatggagg ctaccatctt
12361 ataacctccg agcttgtgaa cgatctccag tatactctca atagagaatt tgtcaacatg
12421 ctgcttcatc agattggaga ttcggctctg atgggttcca caccgctctg ccacttcccg
12481 ttgagtcagc ccagactgag tgatgtagtg tgcagcaaca accattacag ttttcttgaa
12541 atccttgacc ggatcattca tgttagtcct ccttattgct cagcgttact ttgccatcga
12601 atactcggaa ttgagcgatc tcaaactgat ccgtccagcg ggcgtcctcg aaagccactc
12661 cttcaaaagt cccgtcttgt ttaacatcag aagtcatgag gacgataaaa ggaactccgt
12721 cgtcatggat cagttccacc agagtgttag ctttaggttt aacatcctcc ttgtcacgcg
12781 aaatcaacac attgaccatt ctttcctcct tttatttatg gtggtctaca accacaaact
12841 cttgctctcg catatattcc ctcacttcgt cgtaagagaa tacctgatga tctgggtgat
12901 tgtcaatacc tacatcaagg cgcttaccct tggaaggcag gctaccgtga gtgtgaccat
12961 gcaggtgcca agcgccatga tgagcggtat tccacgtctc gaaaggatag tggcacatga
13021 cgatcttaac tccgtcgatc ctcacttcct tgtagtctcg gatatcttcg acgtgcgata
13081 ggttgctgtc ttcaatcagc ttccacagtc ggctatcaca gtgattaccc ttgaggaagg
13141 tgatccgacc gttcaactgt ctaatgatat ccagtacagc ttgcagcttg ttcttacctg
13201 cgaaagcgaa atcacctaag tgatacactt catcccgaag acggacccga gagttccacc
13261 gagagataag ctcctcggtc tgctcctcga aagtccacgg cctgttgcaa tactcgatca
13321 cattcttatg gaagaagtgt agatcggaag agaaaaatac agacattatg cctccatttc
13381 aaattcgtaa attttgttaa tcctgcggat gagtcgcata gcggcccctc ccagcagatg
13441 ttcacgctcc ggctccatac tagccatagc cttgaactct gataacatat ctcgatgctc
13501 gtagtggaaa tctactaccc agtaatggtc cgcactaatc ttaccctctc ggtacagatg
13561 cccttctacg cccagccagt gatctactgc gtctttcttc agaagctcct tcggagacca
13621 cttatctaca cctcgcagct tctcgaagaa agagtaagga cgcgaatagc tgatgatagc
13681 ttcctctaca gccgattcag cctgcaattg gactaactcc catcttgcaa ggacttcttt
13741 aatctccccg gtggtgactg gggtgtagct gtactgctct ttatattcat tccacactgt
13801 actgttctcc tacatagcct ttgaatttgt cggaacgagt tgtcttcttc cgtgccttgt
13861 tttccagaac tgatgcctcc ctttcgagca tgctcagttg gttgctatac ttcttgatcc
13921 gcttcgagtt accactcatc acagaatttg taagatttgc gatagtatcg caaattttca
13981 cttctcttgc aaccggatga ttacggcaag cttcgatata cttacggtag ctctcagcac
14041 ggttcttatc gagaatgacc aaagcctcta cgatgtgagg catcacgccc atggactcca
14101 agtcttcctc tgtcaactct gtatcctcca gaacgtcgtg caggaagcac acagcgagaa
14161 gagtgtccat gtacggaagg tcggagaaag cctgacccgg gtccatatct ttaggagcgt
14221 tgcgagccac gcagactgta tgcacctgat tcagatggta agcatacggg aagttggtct
14281 ctccgtaccg ctgaccttcg tgagccgaga gtgcgatctc aatagcgata ccaagctgag
14341 tgttcatatt agtctccttt gtagaatgtg tggttgccta tcttgattgt gcgcttgtat
14401 ttcctagccc accgaggaag cttgccatta ttagcccgtc tcaccttcct ctcgttgagg
14461 tagtgatcgg ctcctctcgt tggatcgaca gtatacccat atagggcgtt gtatgcaaca
14521 tgtttcgctg cctcccactt gtcaagctcc ttgacacctt gccgcatact cccatcgcag
14581 gtgtaggaat actggcactt gaagtagagc actccggcta ctgtgctcgg ccacctgtcg
14641 tgcttcattc tgttcactac ggtatgagct acagcaatct gaccgatctc cggttctccc
14701 cgggcctcga agtatacagc ttcagccaac aacctgcaag gctttctgta ctcacacaag
14761 gtgcgcttgc tttctatgat ttgaccggga ctggcttgga attccactac aggctccgtg
14821 ccgtatttta gacgagagta ttccatgtcg aggaacatcc caatgaaggc tagaaggatc
14881 gacaaaacga gagcttctaa ggtttccata acacctcctt agacaaagaa gcccgccttg
14941 tgggcgggct gtatatcact cggctattat acttcagccc aagttgtaac gacgggcgta
15001 gtctttgttg gggaactcga ccatcatcga ctgaatgtga atgttgcctt tacgatcctt
15061 ctggattttg gcatttttca caatcttact agcctgcgcc tttgccataa gctctggact
15121 tacaaccaga tcgatgaatt ctgcactccg atacccggca ccagccgggg cccagaagcc
15181 gtactgggtc accgtcgatg taggtacaag gtacaggttg tgcagacgca cagcagtgtt
15241 gaaactcagc ttgctgatgt gcttcgcttc ccgagtttgg gtttcaaaac acccagtcgt
15301 gtagttgaat ttgtaagtga gagcatccat gaactgaatg acgcttcgaa tctggatagc
15361 agaagtatcc aagagctgga actcctcagc cgcgtcgatt gcagtggtca cgttgacaga
15421 cttagcgttg aacattttat atcctcctta ttcttcaggg acaaatacac cgccgattac
15481 ccggccagcg cgaattagtt taccagttgg gaactgagca cgcaaggtct ttttgaaacg
15541 actttgaatt tgcacagtta gccacttacc ccggtagttc tcaaaattag tgatctgatc
15601 cttgcgttcg tcaaagtcac cgtacgtcac ctcaagcagc tcttgaggta cagggtcaaa
15661 caccaccaga acagcgttcc cattcttgtc taccacgtag ttcacgatct gcatttccat
15721 atcgaagaac tctttgtact tctggagacc actagaacgt ttacctgatt cgtacagtcc
15781 ttcaggactc cgccacatga taccttcata gcctttctgt cgatacacat catgaagacg
15841 tttcagttct tcaaaggtgg agcagaatac gtactcgacg aagcgaattt taccgatccc
15901 ggcaacagtc gcagccttga actggaagtc taccagacgc tccttgaatg tcaagccttc
15961 tttcacgata tcgaatacgt gaaattccat ccgcttacga agaccgtaaa taaaggacgt
16021 gctgtccact tcattcagga gacgatcata ctcctcctct ccgttctcta gagcgtaggc
16081 gtcaagagcc ttctcagcct tcatccactt atcgtaggca tcctctcgct tgaccgccga
16141 gttgatatcc tccagcacct caccgtggac gtacagttcg ccgtcccaca catcaccctc
16201 ttgcatgatc tcttcgagtt ctttgatgat gtgcggtaca ttgtaaggtt tacccatgcg
16261 agacgctagc gtaactacgc cattggcttt cttagccatg caacgcaggc cgtctagttt
16321 aggagagcca tacccctctt tgtatttagc gggatcaagc ggttttgcga gcatagccat
16381 aacagggaga tcgttgagtt cttccttggc tgcacgataa cccttgtcca actgcttgct
16441 caccttagac tgagcctcag acacggcctg ctcctctaca gagcgtttct gcttaccaac
16501 tcggatgttg gtaacctgag aggtcatggc tccatgttct ttgccgtatt tcacgacaat
16561 attgaagcta ccgtcttcct ctccgaccac ctctacagtc cactccttga acccgccttt
16621 cttgtcgagt ccgtacagtc gttgaaaata actcattgat cctcctcgta tttgatgaca
16681 agaacatcat tctcccgtag gtgcctaaga ccttcgtcga gccgatattc gtgcttatag
16741 tacactactt tgatcccagc ttcaaccacc gagatagcac aatttttaca gcaagaatga
16801 gtgacgaaca gggtagcccc ttgggcactc tcagggctgc gtataagggc cctcagtgcg
16861 ttttcttcgg catgcctcac ctctgccttg gttactcccg tttcgtcctc cagcggcccg
16921 tttaggtgct ctggaagggc attatacccg caactgatga tacggttacg ttttactaga
16981 actgcaccaa ccttggaacg agtcgagtcg ctgcacttag cgaaggcctc agcggcctcc
17041 atgtaagctt taatatgctt gaccttcacg actagcctcc aattagaacc gcgatctcct
17101 cgtagtaccc ctcttcaggg cacgcgaatt ccatgtagta ctcgtcagtg tctgtcaaat
17161 agacaacgct aggcgggtaa tagctccaag tcgggtctcc gtgttcaatc tccgctacct
17221 tcaagttgcc atacacagtg cgaagagtct gtagagcctc gatcacatcg tcgatgcgca
17281 ttacagtggg ttcagtcggt tcagtcatat ctcctcctta gttttctact ttacaaacgg
17341 catcgccccg gcgaaggaac acttgcactg atggctttcc gctccacttg tcccacgctt
17401 cagctttaac actgacagtc ttaggattga ttgcaaccac ctcgcctacc agcataacca
17461 ttccagttcc gcctaggcag aatgctactg cgtcgccgat ctcgatatcc cttcctgcta
17521 cgtccttcat ttgtactctc catctgcacc cttgattaaa ataacgaagt ccgagggatc
17581 atcactgccg taggcctttg cccgaaactc ctgctcgtat ttattcaccg cctccggatc
17641 acttttaacc tcaagctctt ggtagaggtc ttccataaac caacccaagt ccgtggtcgc
17701 agccgaagcc gagaggtgac caagaagtcc taccagcata ttgatctcgt cgctctccaa
17761 ctccaacttg tgaccgttac gttttactac tttcatattt cctcctatcg cttctgtccg
17821 cgacgagtgg ctacgccgta agctggcttg ctcccctcgc ccgtgttgtg tttcttctgc
17881 actcggctgg cattgacggt gtaacgccct ttgccatact cttcatctat ccacgcttgg
17941 gccttagctc gctgagacgt gtggacaaag atgtagtagc cagatgcatc cttgataaac
18001 caagtggccg ggggctggaa gtccagacgt gaaaactctt catagtcgat cacagtcacc
18061 ttctgcttag ccactgtata ctgccccact accgactctt ttgcaatgat tttatcaatc
18121 atctgagttg aaagatcaga gttcttcgag gtcaatttct acctcctttc ctagtccagt
18181 atctgcaaag aagctatcga gactcagagc gtggtattga gacactttgt aaccaccact
18241 cttcagaagg ctgtgagcgg cctcctctac tttgtcctct gtcagtctcc agtccgcacc
18301 taggagtact tcagctaact gctctacact cggagggttc ccaatccaca gacccattct
18361 actgtcaggc tcgtaatctt cttcccatac aagttcccac actaggttac tcattggtac
18421 acctccttct tacgaataga atacataacc cactcgtctt ttcctgtctt cccgcacgga
18481 atgtctactt cacactctgc gtttacaatc aggcccgcta cgatgaaatc aagaagctcc
18541 tcgtctggtt ctggcaagcc cgggtaggac gatacaaccc tgcggatagt ctccgctttg
18601 gtattgccca gtaccccaag catgtggaga tcgaactctc cactgtagtc gtcccagagt
18661 tgtccaaata tcacccatac actattcata cctagtaatc ctccttcagc ttgttggtgt
18721 ccattaggca gcctccttct tcttgtccag caacttaagg catcgtttgc aggtgatatg
18781 attgcggtag cgggagaagt tcttctcctc gaagtcgcca tcggtgccac agaagacgtc
18841 atacggttct tcactgtccg cttctgtgcc gccgtcccac tcgtcgtagt gaactgttcg
18901 cgtcgccatt cacttcacct cgattccggc ttgctggagg gcttctttca cggcatcaag
18961 cactgcgttg tagctgccga ttatcaggtt gccgtagatg tttcttgtgg gctccatttt
19021 ctccggcaac tccaccctca gagccgcgcg gctggcttgc catatccgcc agtcatgatg
19081 tggtgtatcg tggatgtatt gatgcggcgg atgctcatat cgatcaaggg tgaagccatg
19141 gtgcccatcc ttaatttggg ccgcgtagtt acgcacgaac cacgcttcaa actcgtctct
19201 catactccgc aatcctcctg aatctctttt agcagctcgg aaggcataac cgacagcgcc
19261 agttcctcca gagcatggat gtaatcctca acatatttcc actcctttct gatcttctga
19321 aggtacacgc cttctttact gttgtcaata gcctgaccct ccaactcctg cattagttcg
19381 aacatcttgt atatcctcct ttggccgcaa aaatggccgg cgactaatgt cccggcctga
19441 tgatactact ctgaaatttc ttccattgca aggcgtttct tttcaaagaa atcgctgagc
19501 ttgtcttcta gctcttcgcc accgatgtaa agctcttctc ctgccttgac acgctctagc
19561 tccttctcag tcaagaagtc actgtagacg tgatctaccc atttatcgca ccacgctgag
19621 ctaaacgctg cattcctcag gctattcctg aaatcagcag atacaacgcc aaaagaaggc
19681 gcgtggatca tgaaatatgt gaactggtcg atctcaacgg agtcgcaggc tagcgctatg
19741 gcagtcatgg cagacgcaca ctcgccttca agacgtgcat gcactggagc ttgacactct
19801 ttgatcgctc ggattatagc gttggcggtc tctacctgtc caccgcatcc gttaatggtg
19861 atgtacactt catcattctg acctgcattt tcaagggtcc aaagctcctc tgtgagttct
19921 tcgaggctct tgattacgta cggcagaagg atggagtaac gattgctaac actttgtgta
19981 catgaaacag gcataatacc tcctttacaa aaatgggccc gaaagggccc ttattactga
20041 atcactcctc gctttctttc tggccagagc ccagcattgc aaagaatgga aggaggattg
20101 tgctcagctc tccgctgaca gcttcaccaa cttctgcacc agcctgagct acactcagga
20161 attcttcagt gcgtacaaac ttgtcaacct tgacgagggt tttaaagtct actcgttcca
20221 agaacgcagt cccggctgct tccgccagag gttcgaggtt tacgacttcc atagcgcgat
20281 ccagagcttc ctgattgatc tctaggccgt tctgggctgc aacctgcatc agggtagact
20341 tcacagtctg gattgcgtag tctttgaaaa actcacgttg tgctttgtta aacttcattc
20401 acttttctcc tttgtagtac gacgacggcg ggtttttggt ttatcttccg attcagtctc
20461 ttggacttcc tctacaggaa cttccttagc tacttctgta gacttttcct cagtctgctt
20521 ctctgcgcct tctcggacca tctttacaga cttgagagcg aagctcatgt tggcaaagtg
20581 cgggtcgtcg gcatcgattc tgaagccttg atcgaaagcg ttctgcatac ccatcagaag
20641 actgaaaacg tcccattctt gcacaaccac ttcattcccg tcaagctctt tttcgatttc
20701 atccggaacg ccttcctgac ggaacatctg cacttgacag agggtaccgt acacaggata
20761 gccttcaatc gaccgaacga cacggaaacc ttccttcatg tgggcgtgaa tcgagcgaag
20821 ccagacgata gggttgtatt ctacgatatt gataacttgc atattctttt actccttgcg
20881 ggttagtgtt ttacaataat accacgtttc tcaggaatgt caacccattt tgttctggta
20941 aaggcttgac atagaggaaa tctgtggtat tatcaatatt cagcgtggga gagatatgtc
21001 tgaaagcact caccggccca cgcctagcgc ctatgaagag gaatccacaa gggcaacctg
21061 aactcgaatg ctgttaaagg gtggagacga cgcgaaagcg gaatgacagc aatccgatgc
21121 agcctacatg ctgcccctca ccgaactcat ctgcatgagt aagaggaatt ggatagagcc
21181 aaggcacgtc ttaggcagat taaattctgt atggcgagcc ttgggacgac tctatccttc
21241 cctagccgaa tctatctgca tggggtgttc tcctgataca catacacaaa tacccaccac
21301 agataatcca tcaatcaacc cataaggaat ttctatgaga tgtaagtgct gtgatagcga
21361 actctcgttt gagactccag tcatcaataa acatactggt aaggaagacg atctatgctc
21421 ctcttgccgt aggtttgctc tcaatcctac actggatcat gagtattttg gtggttggta
21481 tccaagcgaa ggagttaccg ctcctctccc taccggggac tgacattgta tatagagtgc
21541 gcgtactctg acaatacata taaataatag attacggtgc gaataattct ttaagggctt
21601 gacaacagga gatttcgtgc tataatcgga gtatatgggg cttacaaagc ttcagaggat
21661 ttaatatgac tcaagaaaga aacaagggcg gtcgccctac gaatgccgag ctagaagccc
21721 ggggtatcat tcaaacagac ctaaaagcag gactcagact tctaaagaag agctttgcag
21781 agaacattag gttcctacaa gagcaatctg acaatcctga ggtttctcta caaatgagaa
21841 tcaagctcaa gaaagagctt tctgatatgt tcgtcgctta ctacaaagct gacattgcac
21901 tcaaaaaaga gcttgcaaaa ggaacagaat caggagataa tgagaacact gaagaggaca
21961 agactcccgg agtagttctc gcgttttgat taattgccgc ttcgttcaat ggtaggacgc
22021 cagactttga atctggagat gatggttcga tcccatcagt ggctgccaaa tgtagtaaaa
22081 gaacattcac ccgacaagga atgtgtctcg ctcagaggac agcgagtaat aagtgtcctc
22141 cagaattaag ggtcggtgag cgtaattggc aacctactgg attccaaatc ctcgtattct
22201 ctgttcgaat cggagtcggc ccgccaaatt ggtattgaca ggatggtttc actcctgtat
22261 agtgacacaa attgctcata tagtgtaatg gacagcacaa cggtcttcta agccgtaagg
22321 tctaggttcg aatcctagta tgagcgccaa attagatgga cggaagctaa agtggatcag
22381 catctggctt ttaaccagac ttatagtgag ttcgagtctc acccgttcaa ccaaatttag
22441 tgagtaaatc agatgggttc tgaggctccc tgctaaggag tacgtctgct aacgcggatg
22501 tggatcgaga ccactgctca ctgccaaata attggtaaaa ggtattgaca aatgagattt
22561 ttcatggttt aatacactta tcagatagag aaataattag cgagtagccc tgagtaggtc
22621 gggaactagt ctagaaaact aggccactgc gatgagcggt gagggttcga ctcctttact
22681 cgctgccaaa ttttggccct gtggtggaat tggtatacac atcagtctta gaaactgacg
22741 ccgagaggat tgagggttca agtccctccg gggccaccaa attaagaatc tcttttgcta
22801 tttggttagg gttcgagtcc ctacccggcg actatggccg gtctatggcg gccaaatagt
22861 gagagagcta ggggacgtga cgaaggtagc gctgctttcc gacctccccg gcgctataaa
22921 agttatcatg aagggttgac aaacaagaaa ttcatgataa tataggtaca tagagtaaca
22981 acaatagccg gatagctcaa ttggtagagc acccgaccga taatcggatg gttgaaggtt
23041 caagtccttc tctggctacc agaatttata ggcccattag ctcagtctgg actagagcaa
23101 gcccctgtct agggcaaggt cgtcggttcg aatccgacat gggtcgccaa caaggtcgtt
23161 gtagagatag atggctacta tcatccggct gtaacccgga cgccataggc tagaggttca
23221 attccttcct tcgaccacca aatagcgaga gcgttaagac tagctggagc tgtcactcgg
23281 ctcataaccg aatacaagtg gttcgattcc acctctcgct tccaaattgc actccgagga
23341 accctaagtg gtgggttcag tgtcgctacc tatctcggta aggggaagcg cctaagctgg
23401 cacgggtaat tgagtagctg tgataagcta ctggcagcca gtataaatcg tccggctcgg
23461 gcccgttata gctcctagat ttgaattaga tgctgtaagc cataggaggt gatccagtat
23521 ctcccggaga ggcccgggtt aaaaacctcc tagtttattg ccctcgttgg ccgagaggat
23581 caggcagcag attgcaaatc tgccatacat cggttcaaat ccgatacgag gctccagagt
23641 tttattccgt acggcccatc aaggcgatgg ggctcggctg ttaaccgaaa cgcgctaggt
23701 tcgattccta ggtacggagc caatttccaa aagagactct tcgctttaga agcagagtcg
23761 aacgcccgat acgggcctta ttatctcctc gtagctcagt ctggttagag tgtcggattt
23821 ggaatccgaa ggtcgaaggt tcaaatcctt ccggggtgac caatttaaag cgggtttcgt
23881 atagtctggt tattattctt ggcttccacc caagagacta gggttcgaat ccctaagccc
23941 gcaccaaaag tcgtagacct cagtaacccg gagtaacgcc cgggagaaga tgtgagttct
24001 acgtatacgc gtctgaagct aactaggtag aagcaccggg ttgaaattcc ggaggacttg
24061 gatcgttacc aagcgggcgc accaaacaat gcagttatag attaaatgga taaatcgcca
24121 gactttcaat ctggtgttcc gggttcgatc cccggtaact gctccaatca agtccaagcc
24181 ggaacattcc tccgtatgtg ctttcagccg gcttggcatt attcgtgtgg agattgtgta
24241 gcccggatgc tgcctttcgg ttgtgacccg attgttgggg ttcgagtccc cgcctccaac
24301 caatgtcgtg caatggtata tcgcgttgac gcttttaggc tctctggatc gtaagccagt
24361 aaagcgagaa tagcgggctc tcgcagcaga gcgataggtg gttcgattcc acaacatgac
24421 actctttcct cctcgcctgt gctgaacggt ttcctcctcc tttcccgtct cacaggctct
24481 attccctgcc ctttaagcat ttatggtgat gcaccggctt tgtaacccgg cgaattctgt
24541 tcaagtcagg aatggggcac caattcacta tcaaagaacc cgcaagctcc cgatagggtt
24601 cacactctat aaggttgtag catggaaaac actaaggttc ctgataaaaa actcggacca
24661 atcgcgctag cgcttaaaga ggccagagag aatttcgatc tcagccctca tgttattggt
24721 ccaaaatctt tcaaacagaa agagttcaca gacagcgatg caaagatcac tgtattcggt
24781 ggtgctgctg gtgctggtaa gtcttatctc ggtgtaatgg acttcatgaa atatatccat
24841 gatcctaact tccgaggtgt aatgactcgt cgtactactc ctcagattaa aggcccgggc
24901 ggtctgcttg aaaaagcaac agacctattc aagctcgttg accctaaagt caagtggaaa
24961 gacaaagacg gcaagtttgt gttctcttct ggtgcagtta ttttccttcg acacttcgaa
25021 caagaatctg acaaagactc cttccaaggt tgggaggtta gtaagttcct agtcgacgaa
25081 ggtcagcagt tcacagaagg catggtgaca taccttatct ctcgtatgcg taacccgaaa
25141 tgctcggttg ttccgcacat gaagattaca tgtaaccctg attacaattc gttccttcgt
25201 aaatggattg aatggtggct agaccctgac acaggaatcc cgatccctga gcgctccggc
25261 gtaactcgct ggtttgtacg caaaggcggt aagatgttct ggggagacac caaggaagag
25321 tgcattgccc ttcatggtaa tcccagtcta gcgcctgacg atgaagatca ggtgaagcct
25381 atcagcttca aattcatcgc ggctaactgt ttcgataacc caatcttgat gctcaacgac
25441 cctgagtatg tagctaacct tgaagccctt cctagggtag aacgtgaaaa gctcctagac
25501 ggtagctggc acgctagaga agagggagct ggatacttca caagggactg gtgccaaatc
25561 gttccccacc cgcctctacg ggtgcttaaa agggtacgtg catgggacat cagcggtagc
25621 atcgaatccg aaaccaacag aaaccccgac tggacagccg gcgtgctgat gagccgtaca
25681 aaagaaggct tgttcactgt cgaggatgtt gtcagagagc gtaggttgtt cggaggtgtt
25741 ttcgacctca ttctagaaac agccaagcaa gacggtcaag acgttgaaat tcaaatccca
25801 tgtgacccgg gggctgctgg taaagcttat gctgcccagc taattagaga cctagcggat
25861 catggattcc acgccagacc gaagacaact aacaaatcga aagttactcg attcgccccg
25921 ttcgtatctg tagctgaaac taaatcagtg caagtcgttg cgggagattg gaacgaagat
25981 tacttcgatg aacttgagcg attcgacgga agtaaggcta tcaaagatga ccaagttgac
26041 gctacatcag atgcatttaa tgctctatcc cttggcagct tgattatccc tgatttccta
26101 ccgcctgata tgactcaatc caacaaattc aaactaaatt aataggaggc ggcgatggcc
26161 gagactgaaa aaacagcacc gggtatcccg cgacttcgcc taggcgagat tggtagtaca
26221 ggccttaaac aagtcaatgg tactattctg gaagaacgcc gaccagaact tcggttccct
26281 agggcatgca gaacattcca aatgatggcg gaagacccta ccatcaaatc agcactcgat
26341 ctcttcgaaa tgatgatgag cagggttgac tgggaagttg atctaggagt tgaccccgac
26401 gaggctatga aggcccgggg taagttcctg aaagagtgca tgcatgacat ggaacacagt
26461 tggtactcct tcatcaaaga ggtcactagc ttctacacct acggattctc cgtacatgaa
26521 atggtgttta agcgacgtga aggataccct gtatcgaagt acaatgacaa caaattcggt
26581 attaaaaagt tgccaatccg ctctcagtct actatcacca agtggttgta ttctgaagat
26641 gggagaaact tcctagggtg tgagcaaagc cttgccaatg ttgttaatgg cgaccgctac
26701 gtcaacctag gcaacaagga cggaactgta gagattccag ctaagaagat gcttcttttc
26761 cgggtcgatg ctaaacgtga cagtcctgaa ggtaacagtc ctctccgtgc gtgctataac
26821 gcttggagat atcgagtaga gattgaagag caagagtccg ttggcgtaac acgcgatatg
26881 aacggtatgc ctacgctcta tctgcctcct cgatatatgt ccgaagatgc tacagaagct
26941 gagagggcag tctacgaata ctacaagcga gtaattcgta acattcaaat gaatgaacaa
27001 tctggactta tccttcctca agcgtttgac ccagaaagcc gacaacctct gttcaaattc
27061 gaactgacct cttcgcaggg cagtaagatg tatgatacag atgccatcat tcgtcgctgg
27121 gacaacaaaa ttctgcaagc cttgtttgcc gatatgctga agatgggtca ggaccaagtt
27181 ggctcttact ctctagctgg tgccaagact aacatcatgg ctatggcgat tgaatcgcgg
27241 ctccgcgaaa tcaaagacgt actagataat aaactcattc ctacgctgtt cgcactgaac
27301 ggtgattata gtccagactt gccgaagctg caatacggtg agctagatga aatcgatctt
27361 gaagagttct cgaaagggat tcagagaatc ggttctgtcg gtggtcttga acgtgaccgt
27421 gaggtttaca acaagattcg caaagctctc aagattaagc ctcgaccaga cgacgagcct
27481 gttgatgtgg ataatatcat gggtggtcag tctcaagcag gtaaagctgg agtaggtaat
27541 ggtgcatcaa catccgcagc cggtagagac aacgccgctg caaataacgc ataaggagac
27601 agaatgctga ctcttgaaag tgttattgaa gctctcagca atgctttcgg ggctcccgcc
27661 aaggcggaag aagccccggc tgtagaggtc acaaagtccc tagacaatga aaagaggatg
27721 gctttgtttg tcgttcttga gccccaagaa ggcgactcca cgactgacct acacgcagac
27781 acctactccg aagaggaagt agagaaagct tgcatcaact tcaatacgca ttgcaacgta
27841 gctaatatct tccacaagat tgaaacacag gaagctgaga ttgtccagtc cttcatcgct
27901 ccatccgcat tcacaactga cgacggaaga gagatcaaga aaggtacatg gctccagtgg
27961 tggcacttcc ctgaaggctc tgaagtagcc gatgcactat gggaaggcgt taaatctggt
28021 gaattcacag gcgtctctat cggtgccaga gctacagtcg aggatatcga atgaccgtaa
28081 aagcaaaacg taaactgacc gatatcaagt ttgaacacga aggtgctcat gtcgctctgg
28141 tcagtaagct ccaaggtggt gcagccaacg ggcacactac tctaatcaca aaagctacca
28201 atggcgtaac tgaagagctt atcgataaag ctgctgaagt tacagtcaca atgcagttcc
28261 ctgagttcct tcgtaagttc ttcgggatgt attatgaaga tgccgaagtt ctctctgttg
28321 ccatgggata tggcagaacg gagtatccag aactagatca caaagactgg atcgaccagc
28381 gggtcgagtc tatgtccatt cttaagtcgg tttataaatc ggctgacctg aatcaagctc
28441 tctccgagct tacccctgag cagacccttt cccttaaaca ggatcaggaa ctgcttgaaa
28501 aggctctgga ggtagtctcc gagcaatcca atgaaaatcc atccaaggag attaccaaca
28561 tggaaactat cctgaaatcg gcccacctag aagctctagc tgacgctatt gcagttgaaa
28621 aagctgctgg tgtcgctgct gttgcagaag ttcagaagca actagacgcc gctaatgtag
28681 agcttacagc tcttcgtgaa attgtcaagg ctgctgaggc agagaaaacc gctgctatcg
28741 ctaaagcccg taaagagcaa ctggctgaag tcctcccggc tgaccaagta gaagatactt
28801 tcaagtctct ggaagttctg gacgatcaag cttttgcaca aacagtagga acgctccgca
28861 ttcttaaagc tgctgctgac caaaatgaca tgcttgtcga gaaaggtgta tcgggcgctg
28921 gggaagaaga cgactctgtt gtcgccggtg ttgccgctat cctgaaagct cgccacggct
28981 ccaagtaata tctagccaat ctagaggaat tccaaatggc tcaaaacatt atcgcaaaag
29041 atcatcagcg tcttagcaac tggctgaaag aagaacaaat gggccaccgt ggcctgttct
29101 acactcgcga aactctgcct gtcgctgaca ttgatgttaa aacaactggt tctgtcctag
29161 acagcactgg caagctggta actaaggcta ctatcgccga cgctacctac atcctaatta
29221 ccgacctgca cgactatgcc aacgctcaga tgagccacgc tgtcgtcctt gctcgcggtt
29281 ttgccaagat cggctccaag gctgttatct tcggtgctga cgttgacgac gctgataaag
29341 ctaccgtctt tgaagctttc aaagccaaga acatcttcgc cgttgaccag atcgaaggcg
29401 cattcgagaa cgttaccttc gcgtaagcga gggtcgttcc agtaaataaa tactaggagt
29461 aactttaaaa atggctaaca cccgttccta cctaaacgat ggtcagttct acattgccga
29521 ccagactgaa aacctgctta tcatcccgaa cacttggacc ctcgtcgaga acatgggcgt
29581 cttcacaagt gaaggtgtga ctcagaacac tgtccagttc gaagagatcg aaactcgcta
29641 cggtctggtt aaggatgcca tccgtggaac tcgtcaccaa gttgctagcg accaacgtcg
29701 tcaactgcgt gccttcgcga ttccgcactt caaccaagac gactacatca ctccagaaga
29761 cattcaaggc aagcgcgctt tcggtgctga ccgcgaagaa actctgaacg aggttcgtgc
29821 tcgtaagctg gaaaccatcc gtcgcaactg ggctaacacc gctgaagttg cttccgttag
29881 cgctatcgta acaggtaaga gctacgcccc agccggaacc atcgagtacg actggtacga
29941 cctgatgggt aaaactcgta aggttgtcgg cttcgacctg accaacccta ccgctgacgt
30001 tatgggcaag accgaagaaa tcttcgtcca tatgcaagac aacagccaag acggtctgat
30061 ccgtggtgac ttcgttgccc tgtgctctcc tgagttcttc actgccctga ttaaccatcc
30121 gagcatcaaa gagttctaca aagcttacca agctagtcct caatactggc gtgaacgtct
30181 aaccgctcgc ggtctggacc ttcgcttccg tgagttctac ttcggaaaca ttcacttcat
30241 cgaataccgt ggcgttgacc cgtacggcaa ccgtctgatc ccggctggcg atgcttactt
30301 catcccaacc gacagcggtg acctgttcgc tcgttacttc ggcccgggca gcactttcga
30361 tgacctagga actctgggta aagaactgta cgctaccgag cgtatggctg aagaccgtcg
30421 ttcgatcctg atcgaaaccg agtccaactt catccacgtt ctgcgtcgtc cacagatgat
30481 cgttcgcggc actgtgaatg cgtaaagact tcagggaggc ttcggcctcc ctttcgtcgt
30541 aggagggtac caaaaatggc ttacactggt gatccagcaa acaaccctat cgaccgtcta
30601 cgagagattg taggggacgt gtgggagcct ccgatgcttt ccgacgaaac ctatcaatgg
30661 gtgttggaca agaacgaagg caacgaaaga cgagccgcac ttgaacttat gcgtatgatg
30721 ctcttccgcc tgacaagggg aatgagagaa cgcacaggtg atatcgaagt atatggtgct
30781 gagtatttca acaactactt gaaagctctt cagctcattc tcaaagaccc gaatattaca
30841 atttctttgg ccgtgccata tgctggcggt atctccaaat cggatatgct ggctaatgac
30901 ctagaccccg acaacgtaac acgggaattc tacatcggtt ttgcaagacg ggagaagctt
30961 tacaaccagt gcaaccccgg tcctcaagac cttagcattg ggtgtgatta tcttggcaag
31021 cttcagtttt aaaacagatc gccgtcgcct cacatccttg attaagaggg tggaggctct
31081 agacggaaca acggtagaag ttggtttctt ccccgaggac cgatatggtt ctgaaaatgg
31141 aaacctacca gttgcacaag ttgcagctta caacgaattc ggtactactc gcaacccaac
31201 ccggccattc atggctccaa cctttgaaga attcacatct caattccact acgcaagact
31261 aatgaagtct acgtttgaaa acgttatccg cgatggaaga caggttaata ctctcctgaa
31321 gaagctgggc agaatggttg cagagcagat gcaagttaac attgacgact acccgggctc
31381 taacagtccc gcatgggcag cttacaaagg gttcaacgat ccgttgttcc atactggcaa
31441 gatgcttgag tctgtcaagt tccaaatcca tcggaggcaa taatgctcta tcctaccttc
31501 tccatgacca actttgtcaa gctagatttg attagaagag ggcagcccgg agacgacggt
31561 tttggaagac ctacccctcc agttgagaca gtagtgacaa tcacagctaa cgttcaacct
31621 atcgaaaaat cgacagacac tcgtatcctt ccagaggccg acagaagcaa ggcttgcttc
31681 aaggtgtact ccagaggcga agagattcgc cagttaaagg aaggccctaa tgggtggagt
31741 gcagataggt ttatttggga aggtgagttg tacgaggtga tgaaagtcat caactactcg
31801 atgggcatcc taaaccacta caaagcgatt tgtatgagag tagagaggaa tagtacagca
31861 tgatccatac agagctagaa aactctctct atcttatgat aaaagagttg ttccctgatt
31921 ggcgtgtcat ccaagcatac acaaataatc aggaaccgca aaccccttat ctggctatcg
31981 atattaagaa gctagatgaa ctgggaaggg aaaatgtctc caacatgagc gatcccatta
32041 gtccttcgca tggaactgtt caagttcaac aggacttcgc agccaaggtc gtattcgaac
32101 tagttggcaa gtatggagag acagcaagtg tctctgacat ggcaatggcg attactcggg
32161 ctctgcgtac tccagcagga cacgccgccc aaagaaagtt taatctatcc cttttcaaac
32221 tccctagcac aagacgagtt cctatgctaa gagaaacaga tatgtacatg ttctatcaag
32281 ttacatgtga atttggattc tctgtgatag aaaccacaac tcaagagttt gctgctgggg
32341 ctgatattca cggcgtttat tacgacgctg gtcgcccggg tcacattatt gagtcccaca
32401 tcgacataaa cttcgaacac taataggaga caggaatgac tgttcttact gatgtaattg
32461 acattcagat cagccgtgag actgctgctg tcgcacagac aaacttcaac gttcctctgt
32521 tcatcgcttc tcacacaaac ttctcggaac gtgccagagt ctacaacagc ctgaaaggtg
32581 tcgctgaaga cttcggagaa tccgatccaa catatcttgc cgctgttcgc tacttcggtc
32641 aagctctcaa gccacgcagc ctagttatcg gacgcagaca agttccttct gctaccgtct
32701 ctgtcagtgt tgttcaggaa ggacaaagct acgtccttac cgttaacgga ctacctgtca
32761 gctatgttag ccatcaagac gacactgcca ccctgattgc aactggccta aaagctgcat
32821 atgatgttac ccctgttgtt ggcgttaccg taactgacaa cgaagacgga actctgactg
32881 tcgcttcgaa cggagactgg agcctgaagg tttcttctaa cctgactatg gctgctgctc
32941 cttctactga aggttggccg gcaactatca ctgctgttca gggagaaaac gacgaatggt
33001 atgctctgag cattgacagc cacgccgatg atgatatcat ggcagtagct actcatatcg
33061 agggcaccaa gaaagtgttt atcggagcca ctgctcaggc taacaccaag acttccgcag
33121 agaatgacat tgcttctcgt ctggtcgctg ccgggttcca acgtacggct ctaatttacc
33181 atccaaacgc tgacgctcaa ttccctgagt gtgcttgggt agggtaccaa ctgcaagagc
33241 aaccgggtag caacacatgg acccataaag ctctggccgc tgtagacgcc taccgtctga
33301 ctccaaccga gtctaccaac ctgaagaaca agaacgttac cacgttcgag cgcgttggtg
33361 gtgtcaaccg tacattcggt ggcgctatgg ccggtggtga atggatcgac gtaatgattt
33421 tcgtggactg gctggaagcc cgcatgaccg agcgtctgtg gttccgtatg gctaactcca
33481 agaaaatccc ttacgacgcc gttggtgcaa caattctgga atcggaaatc agagcccagc
33541 ttaacgaagg aattcgtgtt ggtggtctgg ctgaagctcc ggctcctaaa gtcttcgtac
33601 ctgatgttct atccatgtct ccgaacatga gagcacagcg tatctttgaa ggcattgaat
33661 ttgaagcccg tctggccggt gccattcact tcgttcacat tcgtggaact gtgaccgtct
33721 aaggacggtc cttcccataa ggagattact aaatggctgt tcaacgtcta gcgacattct
33781 ctccggctga tgttaccatt gttattactc accctgcaac tggtgagagc atggttctcg
33841 gcggattcag cgaagacagt atcgttaaca ttgaaagaaa cgctgacact tacgtgatgt
33901 ataccggagc cgacaacaca tcgactcgcg tctacaacgc ctctaagtct gctaccctca
33961 ctgttagcct tcaacaaact tcgccttcga acgacttcct gactgctctt tacaactacg
34021 acgacgcccg tcgttcgtct gagggattgt tcacaatcca cgttaaagac aactctggtc
34081 gttccgacta cttcagtgat gacgcctatg tcggtgttgt tccgggttct aacttctcga
34141 acagcatgca gacacgcgat tgggttattc atgcacacaa cctgcaaact ctaatcggcg
34201 gtaacgccaa gctgagcccg ggtgatgcgg atactcttcg taacctaggt gtcacactag
34261 accagcgctg gctgtaatat agcgcttatg ccacatcgac ggggagctgc cttaacgggt
34321 ggctcccttt gttgtttctg gaggatagaa attgattacc acctactcgc cgcgtgacgt
34381 ggttgtaact ctcgctggta tccattccgt gacagggtac gcagagggag agtttatcag
34441 aattgtaaaa gatattaagc ctttcatcaa gcacggttcg atggatggtg aaatcgcaag
34501 ggtctacaac aaagaccaag gctggcgagt agagttgaca atcatgcaat cctcgccgac
34561 caatgatatc ctttcgatgc tttacaacgt ggacattgca acccgaatgg gaaaattccc
34621 actgatgatt aaggacacga agggttctac aagcttccta gctctgacag catgggtgga
34681 agacctacct agggtatctt tctctggaca actggagacc cgcacttgga ttctagggtg
34741 ctctgaggtc gccatgaaca ttggcggaaa cgtcgatcaa agtttggtcg agcaagctat
34801 cctgctggga agctctcttc tgccagccct tacgcaattc ggaggcttct aatggctaac
34861 acggtattga catatagccc atctgatgtt aaaattgtcc tttgtgggta tgctctcact
34921 ggtgtagttt ctttcgaaat gtcttggctt tcgagaccct acacaatggt tcgaggaatc
34981 agagggcacc acacccgggt cttcaataga gacctttctg cgcagattag aatcgaggtt
35041 cttcagactt cggtgtctaa tgatgcattc ttctcgctag tagagcaaga ccgaagaaca
35101 caatccgccc gaatcacctt gtctgtcaag gatacccacg gtagcaccat gatgagcaca
35161 gacaacgctt atgtcaatgg ctaccctagc ataacattca ccgatggaat cgagaacagg
35221 gtctggacta ttgatgttct ggactggacc gatggcacgg taggcggaaa ccagcaagtc
35281 ggcttcgacg tgtttggaac tgttcaaggc gctcttagct acctcagata aataaggagt
35341 atttatgttc ggaaaccaac gtactgtcat ccacaatggg acagaataca ctatcaacct
35401 tctgccagca actcgcggta tcagcgtact gaagcagcta accagcttgc tgggtccatc
35461 ccttgccaag tatcaagctg accacgactt ctctggagcc atgaaagaac tgttcgataa
35521 catcgacaag gttcctgttg agaatttgat ccagaatctg atgctgacag ttttcaaagg
35581 ttcgatggca atcaatttcg acaccgaatt cgctggcaag tatgacctgc tgtacgcact
35641 cacaaaagac gtgatcgagt tcaacttcgg ctcggttttt tctctaatcg gtttcgcaga
35701 ggcaccgacg gtataaagac cggggatggg cagtccgaga cttcagtcac tactgatcga
35761 gttcagagtg atcggagggt tagggaggcc caccagaagt tctcgcagca ttgggagatt
35821 tatgtggcta tcactcaccc tctcaagcta acgacgtatg gggaactgag tacagtcctc
35881 actacagaag atttgtacaa catccttgag gttatagacg ttcacgatac tatcactcaa
35941 gtggcaaaag aacacgcaga ggctgataag aaatgattac agaaaggatt gcccagctaa
36001 ctggggaact taaatttaca gtcgattccc ggcctctcac tgcttttgac aagaagctcg
36061 ctggggtcga agcccggcta agagaattct ccaagctgac gaacaagcgg tttggagtta
36121 agctaactct agatacaaaa actctgagag aggagcttgc caaggcagcc actcaaaggg
36181 tagtcttgaa gaacatcgcg gtagatgctg ccgctgttcg tcttatctct gagaagcttc
36241 aagaaagact gaatgcaacg ccgatcaggt tgaagtctgt taggctagac cttagcggta
36301 tccgagatca gaaaaacttc gtaaagacgg ctctcggcca gaccaaggtc gatctaccgg
36361 ttgaactggg cttggctcag gctagccgta cgctgtatga atggaagaag cgcacagaga
36421 gtcgttttaa aattcatctg aatgcagaca ttagccgctc taaattgctc cagaatgcac
36481 gaaacacact aagggatgtg cagggtaggc taaacggtct tgctgtcgct acgcctcaaa
36541 ttaggctgtc tgtagaccgt gcccatcttc gtagagagat tcaagatgtt cttgagcaaa
36601 tcagacgcga agtgagaatc cgcattgacc tagagtcttc catccgagga ggtggtgcag
36661 gtggatcgag aggtactgcc ggccatatcc gtcaaggtat gggaatgggg attggtagcg
36721 agctagccgg gtggggacgc gggtttattc ccggccttgg tggtgcgttc gctattatgc
36781 agcttaaccg tgctaaccaa gaactgcaag gtcaacgtct ggccatgcaa gctgtcggtg
36841 gtggagtaca gggtggtcaa gagctacaag ccaccctccg cgatatctct cagcgtctcg
36901 gtcttgacga tagagcaata ggtagctcct atgttaagat gatggctgcc ggacaagcat
36961 ccaacttcga caaaacacag gttgatggta tcttccaatc catggctgaa tatggacgag
37021 tgatgggtct ggacggggag gctatgaaag gctccttccg tgccgtagag cagatgatgg
37081 gtaaaggaca gatcatgtcc gaagaattga aaggtcagtt ggccgaaaga ttccccgctg
37141 ctgtagctct gatggctaag tctcaagaca tgactatcgc agagctaatg aaaaccatgg
37201 agaaagggga gcttaagagt gatgctctga tcccattcgc cagaactcta gcggaagaag
37261 ctcgtaaagg tggcgctctg gacgcggcta tgcaaggtac agccgctcag cagggccgat
37321 tccagttcgg atggaaccgc actatcgagg ccttcgcggc tggaggattc gaccgaggaa
37381 tgagcgactt cttcaagatt gctgcccaag gcatgaaaga agcgcttcct ctggtaactg
37441 cacttggtgg cgggttcgaa gctcttatga ggcctgtcaa cgctctggtc ggtattggag
37501 gggagcttgg ttcccagtgg gagaacattg ccaagcagtt caacatgacc ggcacagggc
37561 tgactcttac cacggctcaa accctagcct tgctgacccc tatgggcagg ttgatctctg
37621 ctattagctg gggtgcgttg gcactggaag acttcattgt cttcttggaa ggcggtgatt
37681 cggtgttcgg ggacttcttg aacaacaacg tacaagctgc cgagacattc gaaaagctag
37741 ccagtgaatc cagtgaactg aagaacaatc tcgacggtat cttctctgtt gtcccggggc
37801 tagctgaagc gctcaaaggt ctagagttca atgaaatgct ggtcagcacg atgagagaac
37861 ttgctgccat catggagttc ttcaacagtg ttgtagagag attcgcaata gccggcaagt
37921 acagggacgc taagattgct gaagccggag gagacagaag tactataatg tcgaacatcg
37981 acacgatgta cgctatgttc aatccggaag atgcaaaaga caaggccacc ttcatcggtg
38041 acaggctagt agctcagaac attgacgcga tccagacaga gactcatacc cgtgcaaccc
38101 agtccttgac tccagaccag tttgggtata tgatgcaacg tggtcaagtt agaaacgaaa
38161 tggagggtgc cctcaagaag agtgccattg acattagttt caacctcaat gtttctggta
38221 tcgatgctca gggtaacgtc atgacaactg aagcgcaaga gcgagtacga gagatcgtta
38281 gtaacgttct tgaggaagaa atctccagag cttcggcaag ttataaggaa tcccaatgac
38341 aattgctatc aaaagagaga acggagacct aatctggttc gacgctgtta cagagttcgg
38401 aagacagtac cgtggctctg tgagttccaa cccaatcgaa acgggaggaa aaatcacaga
38461 ccacattact acagaaaacc cagtcttcac tcttacagcc atcgtatcag acgcagactt
38521 caacttgaac aggcccgtta tcaacgacaa cgaggcccag acatacaaga tcaacaataa
38581 agagttcgtg aatactcagc cggtcagtgt gccggctgtt atcacaactt ctagatttga
38641 tccgagccga atcttcccgg aagttattac tcagtttatt cctcctgaga ttccttctgc
38701 aactgtcctc cctcaaaagg gtgataaagt cgcttatgat attgagcgcc aactgatcga
38761 catgcagcgt aatgctgagg tcttcagttt gctggacttc cgagacggta tcatctggga
38821 tcaaatcgaa agatgcatct tcaccgactt gtctttcact gaaaacgccg agacaggtag
38881 cagccttcaa cctcgtatga caatcgaggc tgtgacattc acagacactc gttatatcga
38941 ggttagggtt aacaagggta gaaagaccgc taagaaagaa aagagagaca ccaaagaagg
39001 tgataccgag gctagcaatg ctaccagcca agactctcct acattcaagc gtagtcaaat
39061 gaaagaggct cagattagaa ctcaggttgc gaggtagact aaatgagcac gacttatatc
39121 gacacacttc ctctctacca agaccggaag tacagatacg cagtagctat cgagggaatc
39181 tcaagagtcc ttcaattcta ctggaatagc cgctctcggc agtggcacat ggatatattc
39241 gacgaggaac ttaaccctat cctgacagga ctggcggttg ttcctcagta tccgatcatg
39301 gcagactacg ccatgcaaca tataggtttc aatggctact tcctactgat gcctgtcaac
39361 ctagaacagg tacagtataa gcacgatgca agtgacattg taccacagtt tttcgaactg
39421 ctatacgtga acgttgactt ggaggatgac gtagagtgaa acaatatgac agagtgtata
39481 aactaacgct cggtaacact gaatccgggc aaggtgtaga gattacaaac ctccaccctg
39541 acggaagttt gaacagagag ggacttcagt tccggtttga tatctctaaa agttcagata
39601 acaagaagag cggaaactcg gcgactgttg agatatacaa tctgtctatt gccactctga
39661 acattcttga aactgagtat ctgacgtgcc gactagaagt tggttataag gaaatgggaa
39721 cttctgttgt gcttgatggc aacgtggttg aaacttcgac tagaaagagt ggtaacgatt
39781 atgtcactca gcttattcta ggtgaaggat atacagcact aacagagacc aagctgaagg
39841 gcacagtatc tccgggcaaa actgtaaagg atgttatcga agaaattcgt cttcaaatgc
39901 cgggagtgga cagaggagct tatacaggcc tcaattgcaa caacccgatc atgtatggat
39961 accaactacg tggactggct aaagacgcac taaacagtgt gtgtgaagcc aacaatattg
40021 aatggaacat cagtggaaac gttctaaacg tcacagacgt taacggccca acaacgaaga
40081 gtgttcaaat ggctcctctc gtaaacagag agaccggcct gattgatatc ccattctacg
40141 ccagtgccag cggaacagca cagaagaaag accagcggag acggaggggc gttcaattca
40201 aatgccttct caaccctgag ctaactcccg gggttcttgt ccgggtagag tcggacagat
40261 tgtcaggcac tttcagaatc aacaacgtcc gaatctcggg cggatacaga gacaacgaat
40321 ggtacactga atgctggtgt tccgatctta accaagagga tattgaccaa tgaggagaac
40381 aggcctacaa gagcttctga acctgcactc gtccacagaa ggttcgaagc agtacactgc
40441 cataccttgt gtggtattgc gcgttctgga cgattttaga cgcctatctg tcgatgttag
40501 accagtggtc aacgacctgt acaaagacgg cacatcggaa gagcaaccag agattctatc
40561 tgtccctgtc attatgccgg gaacagctaa cacacttatc agcttcccat tgaatgttgg
40621 ggatacggtg ttgtgtgtat tctctcaaag aactatggac gtgtttaaag gttccgccac
40681 cggacagcca cacactccaa acgatcttcg taagttcaac atggcagacg ccattgccat
40741 tcccggcctg ttcaccttcc ctagatcgat gaacgaccct gcaagacata gttggccgca
40801 cgacaccaaa gacctcacta ttgcccacaa cctgatgact ggacaagagg ccgaggttag
40861 gatcaaagct aatggagaca ttctaatcaa cagccgtaag actataagca ttaatgccca
40921 aaatgtcaac gtaaagtgcg cttccctcac tgttgatgca gcccatacaa catggaacgg
40981 gaacattgca catacaggta actacgtgca gactggtgga acctctacat tcaacggtat
41041 tccattccat acccacaaac acggtggtgt tatgccgggc ggtggtgtta ctgctgtccc
41101 acaagcttaa aggagatcat atggacttgt ttgtcaaccc cgacacacat gacttggttt
41161 ttataaatgg tgaagctcca gtcactcaac gaatggttga tattgtcgct cagcgactaa
41221 agatcaaact gtacacattc ttaggtgagt ggttcttgga tgatcggatc ggcatcccct
41281 acttcgagag gattcttggt aaatctagga gccttcccgc tgttgacgcg atattccaat
41341 ctgagattat gagagacccc ggcgtccttg agattacatc ttggcagtca gggatcgacc
41401 ctcacacccg tgaatactcc atggagttca cagtcagaac cacagataat acagaatccc
41461 ttcccatcac tttcagaatg ataggagttt aatatggctg gaattacagc agaaggtcta
41521 acgattaaag acttggacca aatcctgaca gactacagaa acgtagcctc tcaggtcttc
41581 gccgacctag tttcaactgg agacgaagtt gacacgtctg gtaactctgc tctaggccgt
41641 ctgatcggcg tagttgctcc atcggacgaa gctatctggg aagttatcca gatggtgtat
41701 aactccttca acccggcagc cgcaactggc gtggctctgg ataacctagt atccttctcg
41761 gcaattagcc ggcatgctgc acgtccgacc cgggctcagg ttgttctaga gggcaacatc
41821 gacaccgtta ttaactcgcc tcccgcgaag atgatttcca gcagtacagg ccgagtgttc
41881 cacctactac aaggcgtgat cctcactcct aaagcttgct ctggtgttgg aatcttccct
41941 cagacagtag gcaacgacct gacgtacgag cttaagatgt acgttgatga cattaacaca
42001 acgtctatca agtacacaag tcctgccact ggcacagtaa catccgagtc catcctagca
42061 ggactggccg ccgacgtagc tacaaatcac ggaaatacct tgacaagcta cgaacagaat
42121 ggtatacttt tcatagtacc tattgaccca tttaacacca agactttcga agaagcctcc
42181 aacctgagta ttcagaaggt tagaaagctt ggtatcgctg ttgacgacgt tattggccct
42241 gtgcctcagc aagctctagc tatcgatacg atctccattc ctattgccgg atgggacagc
42301 gttatcaacc ctgttccagc tatcactggc cgtctgcgtg agaccgacga tgagcttcgc
42361 gagagattcc gaaactctaa attcgtacaa gccaccaaca ttctggagtc cctaatcgac
42421 gggctgatga acgtagaagg agtcgaggat gttaggatta tcgaaaacga tacagacaac
42481 ccagacccag ttcatggagt cccgggtcac tcgttccttc caatcgttct tggcggtatt
42541 cctacagagg ttgcacagtc tatttggctg aacaagccat tcgggattgg ctctgttgga
42601 gatacagagg ttcaggtggt agacagtctg ggatataccc atagagtcaa ctaccagcgc
42661 cctgtcgagg ttccaatcga gatcaagatc agtgtaacaa acacaggatc gatgccagag
42721 aacattgaag atatcctacg gccaaggatt gtagcgtacg ggaccgagaa ttacaagatc
42781 ggagacgatg taatttattc tcgattctat gctccaatca tggaaatccc gggcttccaa
42841 gtgaacagcc tgacgattgc caagaaagga caaactcaag gcatggcgaa cattgaaatc
42901 gggttcaaag aagtggctac attcgccgca gcagatatca ccgtaactac ggtgtaatga
42961 tagaaggaga attccatggc tgtcaaccaa tttgacagag aagattatct ggaggtggcc
43021 cgggaacggg tcactgaaca gtttaaagag aagccgatct ttgatcgctt cctgcaagtg
43081 ctattgtctg gtaagtttga tatccagaat gcactggaag acctccagac tctccggtct
43141 ctggacacag ccaccgggaa gcaactggac attatcggag acattgtagg gcgaccacgc
43201 ggtctagttt accaagatat tttcaactat tttggattcg ctggaacgga gcgtgcaggt
43261 tctttcggaa gcctgtcgga ccctacggtc ggtgctccat ggtactcggt cggtgctcca
43321 actggtaacg ccagagagcc gagcgatgaa gagtatcgga tgatcctgaa agcaaagatc
43381 atcaagaaca gaacaaactc aaccccagag caagttatcg aagcttataa atttgtattc
43441 ggggttcctg aagtattcct agaggagtac gctcccgctg ctgtccgtgt cggcatcggt
43501 aagattctaa cgaacgtaga gcgtagtctt ctattcgacc taggtggtgc aggtgcattg
43561 cttcctaaga ctatcggggt taactacaca tacactgagt tccaagctgg ccgggtattt
43621 gctacagaag gcttccccgg aggacaaggc gttggagacc taaacgatcc cactgttggt
43681 ggaattctga ccaacctagt gacataagga gttataaatg gctgattaca gtcaactacc
43741 tattgaaaat atttggtcca caggcgggga tatggtagcc ccgacccctg cgcagcagca
43801 aggcggatgg ggtattcagt cggttcctcg ccaatggtgg aactggaagt ggaaccttca
43861 cgatactaac ctagcgtatc ttctacagaa gggtatcccg gaatggacca gcactcaaga
43921 gtatattgca aacaaatcgt tctgcacaag gggtggtttc gtctacaagg ctgttcgtac
43981 ccatacaggt agcgacccgg ccaccgctaa ccccaactgg gcccgagctt tcgcagactt
44041 taccacatct agctctgcac ttggaagcct gacaccaaga gacggtggaa tcccgttctt
44101 cattagtgcc acaggagcta gcgtgtttga ctctacggct tatggtcgtg gaatgttgaa
44161 tgtagctaac gccgcagcag ccagaaacta tatttcggct caagaaagtt ctgttgtact
44221 gtctaacctg tccactgtga ctagggctgc caacacagtc ccgtacttca atacggatac
44281 ctccatggct accttcaaca tcacagcgtt cggaagagga cttgtcaacg cggctaatgc
44341 tgaaaacgca agaaatttcc taggactagc taactctgct atcattacgg cagacccagc
44401 taacagggca catactctgg tctatagaga tgctgctggc aacttcaacg ctggcgtaat
44461 cactgctacc ctgtctggaa acgcaactac agctaacaag cttagaaccc cagttacaat
44521 caacggtgtg gcgtttgacg gaagccaaaa cattgttctt ccgggcctag atacaagtta
44581 tgcgggaacg gttgcacgtc ttcacatcaa cggagcgaac ctttcgagtg cagataagac
44641 tactcagcta gcactgagga acaaatctga caacgactgg attagccttg ctgtagtgga
44701 tgacaacatt ctccagtttg tattcagaag cgctacaaac ccagttgtcc agattggtaa
44761 cgaagttatc cttcacacag gaaaccagtt ctctctgggc ccgactctta cagacgctag
44821 gtctcgtctg ggtctcgaca gactcactca aggtagctct gatactcaag tcttccccag
44881 caccttgaac aatggcccct acttgaccgt acaacctacg gctatcggag gattcaacgg
44941 tagcactaac ggatggctgt tccgattcga cgctaatggt aacatgactc atggtacagt
45001 tcctgccgct agaatcactg gtctgtccaa ctcggctcag attccagcca caactacggc
45061 gcaggctaac tctcttgttc agagagacgc agacggagga ttcagcgcta ttgcgattaa
45121 tgcgtatggc actatcgtcg ggtacggctc taacatcttc agtagagcat cgggcactgg
45181 caacgcccac atcgggttcc agagagcgaa cggaacagaa ctcggtctta tctggggggc
45241 ccagtctaac aactcgatga acttccgggt agctggtggc tccaccgcag tgtcgattac
45301 cggtctggac atgactgtta ctggaagagt caatgctacc acactaaacg cctctggaaa
45361 cgtgaatgcg acaggtaacg tcaacgccgg gagtgctaca ctcaatacag cagggaacat
45421 cacaggggcc gcctacggag cgtatggttc tcttaccaac tgggtagatt ctgtatatgc
45481 gaagaaggga gagattccta acgatatcgc tagagcaggc gcagcttggg acgcagttgg
45541 acagtacatc ctagctggcg atcaatctgg agggtctggt ggaccgggga caactagagc
45601 tggaagccag ttgaagcctt attcgactat tagctacaca gcaggggcac taccagcagc
45661 aggcacttac agatgtatgg gagcgtttgc aggtggtggt aaccagatta ccctgtggca
45721 gagaatttct taatagaggg cttcggccct ccttttagag gagattatag tggaattcag
45781 aaatgttgta aaatacaaaa tggggttcga atgcgaggta aatcatcctc agtggggatg
45841 gattccgttc tacgcttgcg attacgacga tagagccaaa ctggtatatg acgccatctc
45901 ccgtgctgtc gataacggag aaatccccga accaaaggac gttacagata gagacctcgt
45961 tgtagatgca cgtctgtgga gagataatga gctaacccgg gctgatcgtc aagtagaaat
46021 tgctatcgac gatgaagacg aagtaaaaga gaaggcttgg cgtaagtacc gctctgcact
46081 acgtaagtgg cctgagcata aaaacttccc agccgagaag agtaaaccca aagctccgaa
46141 ggagtgaggt aagataatat gccaaacatt atgaagccta cgggaatcaa cgctatctgg
46201 tctgaaaatg gccagaaggt tgacccgggt gctgtgaaag tagggctagg ctgggttacg
46261 gaacttcctc cgtaccagac tgcaaacttc attgaatata aacaagacct gtttaacgct
46321 cacgtcaacc aacatggtat ccctgaatgg gatagcgtga cagagtatca gggtaacctg
46381 agctacactc aaggcgctaa cgggatcatc tataagtgcc ttagaaccca ttccgacaag
46441 attccaactg accctctgaa cattacagcc ggatattggc gggtggcgta cgaggatgca
46501 ggggaggcgg ccaaggttca agctaacctt gatcggcacg tgacaaacta caacaccctc
46561 tctgggattg gtaacgtagt tattgcaaga cagaacctga gtgtgtatag taaggccgaa
46621 ggcgatgcac gttatgccat gcggcacggc aacgggtcta acgtcttcag cgtcgctccc
46681 gcaacacagc caactcacgc gatcccgctg agccagctat cgactctcgt tcctcctgcg
46741 accgagactg tagccggggt tatggcagtt gctacgacta tcgagacaga agctggagcc
46801 aatgatacca aggctgtgag tccgctcaag gccgcacagg tgtatctgaa gaagaaagac
46861 aacctttccg gtctgtctaa cgtcactgcc gcaagagcta atctaggact gtcggataca
46921 gcgactatgc cttcttctac attcctgaag gcaggtagca atctggcaga tgtgcctaac
46981 aaggcgctgg caagatcgaa tcttggaatt acaagtagtg ctacccagcc ggaaacctat
47041 ttcttgagga gcgctcagaa cctagcagat gtacctaaca aggcacaagc tagagtcaac
47101 ctaggcctca ctgggatggc tacaacagac cctgcggcgg ttatgatgaa ggcagacaac
47161 cttgctggat tggctaacac tgctaccgct cggtccaacc tagggctagg cacagcttct
47221 actagaaata caggagactt cctgtcgtct ggggataacc tgtccgacct cacgaatgtc
47281 caagcagcta gaaacaacct agggttgaag ggagcggcta cgctcgatgt atggggtctt
47341 cctgcgaata caactgccat ggacttccag tccagtcagt cggatatttc cagaggatgg
47401 gctcgactac caaacggcct tctgctacaa tggggaactg gtcccggtct gtctgatgac
47461 acaaggacga atattcaact ccctgttcct gcccgcatct tgaacgtgca agtgactgta
47521 atggggacgt ttaacaactc catcggcccg ggcgctttca tgacggatat gtggagtaac
47581 acggggttca gagttagctg caactggggt aactggtctt atccgttcaa ctggtttgct
47641 atcacttcaa ccctgtaatt caggagtatt aaaaatggct ctaactgagc aagacttcca
47701 atcggctgcc gatgatctcg gagtcgatgt tgccagtgta aaggccgtca ctaaagtaga
47761 gagtcgtggg agcggctttc tactttctgg cgtccctaag attctattcg aaaggcactg
47821 gatgttcaag cttctcaaaa ggaagctagg tcgtgaccct gaaataaacg acgtttgcaa
47881 ccctaaagct ggaggatacc tcggcggaca agcggagcac gaacgtctag ataaagcagt
47941 caaaatggat agagactgcg cacttcaaag tgcctcttgg ggcctattcc agattatggg
48001 attccattgg gaggcactag gttatgcgag tgttcaggca tttgtcaatg cccagtacgc
48061 cagcgaagga tcgcaactaa acacttttgt acgcttcatc aagatcaatc ctgcaatcca
48121 caaagctctg aaatccaaga actgggcgga atttgcccgg aggtataacg ggcctgatta
48181 caagaaaaat aattacgatg ttaagctagc agaagcctac aaatccttca agtaaatcta
48241 ggaaggttcc taatgaagaa gctattgaaa agctggaagt tctgggctgc tgtaggctct
48301 gcaactttta tggctctgga ggccatggtt catctttggg agcctatcct tcctcccggc
48361 gtattcgccg cagtggccac actggtagct gtcggtgtaa gaatttcggc agtgttcgta
48421 actgctggta aagtggagga agcgatttcg gaaaccatag aagatggctc aatagaaaat
48481 gatactaact aaactcaaaa actacgccct cgtagtagct gccgcaatgg cagcagggtt
48541 tggatatctg tcgttctctt tgtacggcga cttagctgtt gcgaagaatg atatccaatc
48601 tcttcaagct gcgtctcgac agatggaaga gcagttccag aaagagcgag cagggtgtga
48661 gatcaccact gggagactag aggcacatat agcccaaatg aagagccgac aggagcttct
48721 acaaggccac ctgtgtgagc ttgagtctct acccaaccca accccaaggg agacccaaga
48781 aaatgccaca gagacgatct ctgagccttc tactggggat agtctggacc ctgctcttac
48841 aagcttgctc gacagagctt tctgttccgc agtaccaaac gatccttatt gtgcccccgg
48901 caagcctgac cgaggaggtt aaggtatacc gagtggagca agatacagtt aaggggctcg
48961 ctagagctta cattctaaat actaacagtg ctgccatgtg caatagtcaa ctacagacaa
49021 taaagctatg ggcagaagag cagagggctc tatatggaaa gtaaagacgg caaagaaggc
49081 ctaatcaagg tagctacaca gggagttatc tctctgctaa ttgctatcct aatggcttgg
49141 tctggattcc taagttccag tctttctaag caggaagaac gtatctttgc gatgcaaaga
49201 gatatggtat ccgaggcaaa acttaacgca ctagagtcga gattcaatag ccgacttgaa
49261 agtgaaatta gtaacgtaag aagagaacaa caagaaacca accggtattt gattttgatt
49321 atgaatgccg tcaagggtcg ggatacagaa actcaataac tataacccgt taacccacac
49381 tgggagacaa tataatgaca aggaaacaag actggccgct agtttcagca gtcggggctt
49441 tgtttatctc cctccttgtc tgtatggcta ttctggcttt cacagcgatg actcccgagg
49501 ctcggtttga ctctgtacgc cagacctacg agattcgaat tagcgaatct gagcggcggt
49561 atgaactcaa actgaacaga ctacaggatc agataaactc ggcctcgtac acacaggatc
49621 ggcaatcccg tttgcaatat gaagaactcg actcgcttaa aaggaagatt agcgaacttg
49681 agcggagaat aaaagaaaaa caagaataat taagccccgg gagcgaaagc ttaccggggc
49741 tctttgttat gggttttcag cgaacaactt gataaacttc atcgaacagg tcatcaagct
49801 tctggataac cttcttagcc agcttcttgc gaactttgtt agcctctggg ccggaatgga
49861 gtagcttaat atcggacgcg ttgccccagt ccatcgcccc gttgtcgaac agcactttaa
49921 cattcagatg catcgagccc tcgtcaatat cgacaactac gccggtcatc cgagcgttgg
49981 tcttttcgaa ggtcggcctc ggaatgtcta tgtccagact gccaaccata acaacctgcc
50041 ctttcttaac gtcaaataat tccatttaaa acctccttaa tctaacttca ttagtgtgtt
50101 gaactgatgc ctcagagact taaaagcctg tggcccatcg tcttccgctc cttcatgaat
50161 gtggtgagcg ataaggtgta tcagtcctct gtctcccagc aaaatagagc taggaatctc
50221 ttttatccaa gctacaaagc agcagaagtg caatacctct ggcatagaag ccttgaagct
50281 ggaatcgtcc agcttcgaca ggcggttata cgtggctttg agatcgggat aactcaactc
50341 atacgttgca tagtcgtcga tgtgctcatc accactcacc atatattgca agctcattct
50401 acaccttctt gccgccttct gcaaggcgag cttcccgctt gtggtctgca cgggtcatgt
50461 tgtactcgat cttctcgatc atagctcctg caacatccag accccgtaca ttcgcatagt
50521 ccatgatacg aatgatagcg tctgccagtt ccacctcttc catcttccgc tctggcaagt
50581 gatcgtccat caagtcctta cggacgcctt cagcagcttc cgcaatttca gtggtaacga
50641 gcatcagcat gtgcagagca tcacgtttaa tcggctcgcc tgtgaccaga tcggtgttcc
50701 acttgcggtt aacaacctca agaccagtca tcattttgtt aaaaccgcta acaaactcga
50761 agacggactc tcgttcgaat agttcaccga acgtcggctc ttgatcttca acaattgcag
50821 tactgaaagg ccactccatc caagcatcgt agcacttttt gataagctct tgttcatcaa
50881 tgtacgagaa gacaccctgt tcctcaagct gactaatagc ttcagccccc tcgacccaga
50941 cgcacgtacc aataagcctt ggatcgattc tcagagaagt cttgtagact tctttccacg
51001 acctccatcc caccctacca ttgccaaaat acacaaggag tggcacatag ccttctcgct
51061 tttcctgctc tggcgtttct ataactacaa caaacgccgg aactttctcc ccatctggac
51121 gttcagttag tacgaaatct cccaagttga tattctcccg actagctggg cgaagagctt
51181 cctcgatatg gtctttaact ttactcatta acttcttcct cctcacagaa catttcaaaa
51241 tagcaatcac agcataccaa catgccgccg tcatttacaa tttcttcgac cgggagaatg
51301 cttccacagc attcacaccc agcccgttcg acagcatctg cacaggccca atagtccatc
51361 ttcaccctcc ttcactcctc cttcagaaga tactcgttgc taataacctt gaaactaaag
51421 tctcggctca tgcttttgaa taccaaacct tctcggtact taccgttcaa tgcagactca
51481 ccgctggcca ttttaattac aagctgcatg tcctctggaa cgcctacgtc ccacatgtac
51541 actggcacat gtttgaccgt ctcaccacct aactggttca gggtattcag aatggcaaga
51601 cgctccgctg gaagacagta acggctgtcc gaaatgttgt agatatcgta cacatagtat
51661 tccggtttgt caactccctc gaagttgcct tgaatgttcg gtgcaactag ctcaccttga
51721 agggcaatat tcatcccgaa gtaccggaga cgttcaccaa gatcaagctc ttcagccata
51781 gcagtgaagt gattggagtc cttcttaatc acacgcttcc agccacgacc cttgaaaaag
51841 ttcttgacag ccgtgaagaa tccgattttc tcgtcttcca gacggaagcc aacatttcgg
51901 gatgcgacgc ctacttctcc atccttatgc cagatagtga gagacgaacc gtccagcttg
51961 aatgtcactt caaacttctc acccttctga tgagcctgat cgtaggccat tttaatattc
52021 tgcacgcgag tctgatccgt tttcgggatg aagttaggga accctagctt ggaagtgcca
52081 gttcggtcgc ccttgttacc gccattgata gctgcctgct cagacggctt tacatatttc
52141 aggatgccca ttcgatcagt aacgtcttcg tctactttca gctctggact gccggctgaa
52201 tgaacaggca cgatcagtcc ttggctaagc tctttgcgaa gcttcatggt cttgattcgg
52261 gaatattcct ttccatcccg ctcgaccata ttacggccac gcaggaattc aaagatagga
52321 ttatccacag ggaccatgga atccacttca atgtagattg ccagatcacc agcctgatac
52381 tcacctcgtt tgattacgca ctgccagcca ccaacaagcg ccagatcaag gctgtcggca
52441 ttaggatggg tcttcacatc atcgatacgc actactcggg ccagtacgcg gtcttgggaa
52501 ttgctcatat atttcctcct ttattttaaa tttactagat tacttgttag atagattact
52561 tgttaaacca accgaggtca atagctcgtt ctaaggctcg tagcagattc tcagcatcta
52621 gaagatcacg gatcggaatc caactcccac tatttcccgg taagccatct gcgatgtaca
52681 caggtacgtc agtatactcg ctcttttcaa gtctgcaagc acagtctaca ctatctccga
52741 agacaatctc cctgacctct gccgcctcgt ttcgaatatc gatcttcatg gtgtttcctc
52801 ctgttgtgtt gaaagtcgtt gtattctgca cggatacctc cgctgtgtca atagccttga
52861 caagaaaata atccgtggta aagtgggtga cctgctggag agaaatgtcc acgtcactca
52921 ccggccagca gtatagcgta tgaagaggaa agctgcaagc gcatcctgag tcgaatctga
52981 gaacagggca gcgacgaccc gaaaggggaa agctcagagc ctataaggag cccatgctcc
53041 ccgctcaccg actcatctgc atatgcgtat atctgcatga gagcgagagg cagaccagag
53101 gcatgtctta ggcggagaat ccgtatggca agccttggga caggtctgcc tccactaccg
53161 atctatctgc ataaggaggc tacaatgtgt gcagcaactg ttgtgaacag acactacgaa
53221 aaatttgatg tgtatatagg acgaggaagc aagtggggta accccttctc ccacaaggaa
53281 ggcacaaaag ccatccacaa agtagataca gtggaacaag caattgaggg cttccgaatt
53341 cagctttggc ataatataca agaaggattc atcacaatcg acgaccttct ggagcttgac
53401 gggaagaggt tagggtgcta ttgtaagccg cgtccttgcc acggcgatgt tctggttagg
53461 gcaatcgaat gggctaaacg acagagagga gtgtagaaat gaaacatgtt atttaccgag
53521 aagacctcat cgatctgcta cgcgaccgca tgaagctcca agcgctggag gcaggcgggg
53581 ttgacaattg ggactggtat gaagcctccc tcatcgattg cgggtatttc gatgatgacg
53641 ggcgtgagct tgaggtagaa gctcttgcag attgcttccc caccgtaggt gcgtagtcgt
53701 ggaagagtca aaagttacct tcaaagaccc ttaccctagg ttcttcgatg cctctcgtag
53761 gtatggtgaa accaacgact gcatggtggt gagctttgca gtcgtatgga acaccaccta
53821 tgagaggcac accagcacct gaaagtgaag tgcaagcgcg gttaccggca aggggctact
53881 cagaagcgct tcagctacgc agacacttgg tgccctaaga cccggatgct ctaccgggag
53941 gatgctaagg ataagactct taggcagttt gctgaggaaa accctgaagg tcggttctgg
54001 atcgcggtaa agggtcacgc tattgcaatc atcgacggag tgttgtacga tcacactaat
54061 gacaaaagac gcaccatctg gcactgctgg caagtgtggc ccggggaggc acctgagaaa
54121 atcgagagga agcctgatcc aatctcacct cctgtgagaa aggccccaga ttggtatgtc
54181 tgaagattac aactgaggag gaattatgga aattatttcg agagggacgc tccctcaaga
54241 ggttttgttt acggctaagt gccaccactg cttgagcatt ctccgggcta agaggtcgga
54301 acttgagtat gtttcgttct cattctgccg tcccggagag acgggatact actccgcaga
54361 atgccctgtc tgtcacgaag aggtgactgc ttgggttgca gtccctgtca cccatgtagc
54421 acctcctacg acagagtacg tagcaaaggg gcgtgaataa catggatcag ttagcgggtt
54481 ttatgggcga accttttgta attgcattcg attatgatga gacaatcagt ctctaccctc
54541 ttgccttccg aatcgtcatg gataccttca ggggctttgg aggcgctttc aatgtgatcg
54601 tagtcactgc acgccaccct gacaacagcg gagagctaga gtggctacgg gattacgggt
54661 tcccgatcta tttcacggca cagaaggcaa agcgtccatt catggaaaat cttggaataa
54721 aagtctctgt atgggttgac gacaacccat tcagcgtgga taatgacctt cctccgtgga
54781 cagtggagca atacgatgcc tacatggagg caaagaagca acgagctatc aacagaggga
54841 gtaaagcatg agcgagatta tgaaggttga agtgggagat cgggtggtcc ttaaggccta
54901 ttgcgataca tacactggat gtgcaaagcg atgggcgcag gcgcatggac gtttggatga
54961 actgctggct acgggattcg tagaagatag ctgggtacat tgtgatgacc tcgcaggagg
55021 cttgaaaggt actgtcgtga tgactgaact agaagaatgt tgtgcagtac gtctagacgc
55081 ctacaccgat cacagggctg tagtagttgt cgactcgtct gacctgtaca tcgcatgcaa
55141 ggcagcaaaa gctcccgtaa gcaccctaga cgaggccttc ggttgtgacc acgactacct
55201 tatggactct ccggctaacg ctcagcgact gaatgagtct gtcgagcagc tacggactgg
55261 tcaagtcgta gaagtggacg tgcctatgag tgtaaagcaa gacgaaactc cacctgtcgt
55321 agtgcatgta gtagagaaga tttacgatag gaaaggtaac gtacacctca ttctacagta
55381 tgaggtagca ggggcgctaa tcaggacggt ggttgaacag ggagaactca tttacttctt
55441 ggatgaaatg caaggtatgt acttgaccaa gattcaattg gaggtgaaca atggagttgt
55501 atgaccagtg gcgtaagtat atgagcgtcg taatcttaga agaagaagat aatgagcgtc
55561 agtgcatgcg gcttattgag gcagttggcg aactcgatcc ctatatccaa gatttcctag
55621 attctttctc tataaaaact gaaggaggtg tagtatgagt atgagtggcg attccgtaat
55681 caaagcagaa ggcatggaga gctatttcat ttcccactgg gatggttggg atagtatgga
55741 tacagcgtgc ttcggctttt atatcaagcc tgaatacgtt cttgacccgg atattcgaaa
55801 gcttgagccg agcttcttag agcttgattt tgagcgatgc cgattcacat tctggggaaa
55861 cgcagacgaa ggcctagaag gaaagctgat ggaaggtaag atgcacatta tggcccctgc
55921 cttcgagtac gtcttcttca aggaggtttg agtggctaga caggcttacg agtctgcatc
55981 agatagggcg gtcgaagagg ccgtccgctc tgagctagag aatcgttgga aatgctccct
56041 ccataagctt cctagagccc actatatgga ttgggcagcc tgccggaatg gaaaggttgt
56101 tagctttgtg gagcttaagg ctcggaataa tgaaatgcag aaatatcccg acttctttgt
56161 gtcccagatg aagtggctcc atgggatcga aatgcaaagg gtgtttgaca ttcccgcatt
56221 ccttgtggta aagtggacgg actatacagg atatgtcaaa atgacagcca atggcgtcaa
56281 ctacatgagc atgggtggca ggattgaccg tggagactgg caagaccaag aagttatggt
56341 ccatatcccg ctgaaagact tcacacgttt ataggaggac aaatgaaacg actctgctac
56401 cgttgtctgc atcttggaga gcctgtcatg ctccgtcata agactggcat ctggtataag
56461 ggttgcagta aatgtggatc aggagtattc tatggctaag aagaacccgg tgttcaagtt
56521 tctaaacaca gtcaacaagc cctcggtaga gagggataaa accaaataca ggcggaagcc
56581 taagcataaa cagaaggagc gattaaatga agaagggtga taaagtgagg atcaatgacg
56641 acgctgatac catcttccgg ggccgtgttg ccactatcat cgcagtagac gaagagggtt
56701 gcgttattga tgtgggcagc tacgaagacg aaagcggaga gcttatcgag taccttcacc
56761 tgttcttcga gcgctctgag ttgtccaagc aggcgtagga gggtataatg aacggacccg
56821 agtgcagatg gtgtggagag aaaaccgaag ctgagtttgt agacgttggg tttggatgga
56881 tgcagcaagt cactggaggc atgtgtcacc agtgtggagg gtatgagaac ggtcactacc
56941 agaacgacgg aaggctctcc gaggtcgagt ttgccaccta ctggagtggt ccgttcgaag
57001 attatgcgga tttctcgcca ttcaatcata tgagagaagg cgactcgcca tgaaggctac
57061 actgagaaac cacaatctgc tatacatcta cttccacacg ttctcggaaa tgaatgagtg
57121 gttgacagag aacgctgtag atcaatggac agtcacgact ctgggctccg gctatcaggt
57181 ggctgttcct atggaccgtg caatgcggga ccaatacgtc tcggagaggg gttgacacga
57241 acacaaggtg atgctaaact ccgtggttgt ctgaagtaag gaggttttat gtccaaaatg
57301 accgtggccc aaattgcggc tatgcacggt atcgatctgt attctgacca caagaccgct
57361 tgtccccaat gccggaagaa aggcgctgac aacagcggag acaacctaaa ggtctatggt
57421 actgatcgta ataccgggga acacaaaggt gcctattgtt gggcgtgtgg gtacaccttg
57481 ctctctgaag agcaggaaag agacgcccgg ggagaagacg aagaggagtg gaatttcgtg
57541 ggaactgaat ttaacgcaga gatcaacgct caaattaaag agcaatgctc gtatgatccg
57601 cgtggttatc gtggcttgtc taaagagact tgccagtatt tcggagtgct acatggtttc
57661 gacccggaga ctggcgagat tgcaactcag ctatatccta ctactactaa ttacgaactc
57721 accggttaca aacagcggat catgccgaag aacttctctg agcctatcgg agagacaggt
57781 aaggattgcg agctttttgg tcagttccgg ttcaagaata gtaacagcaa gaaggtgctt
57841 attgtaggcg gtgaggttga ccagctatca gcattccaga tgctcaagga gtatgacgac
57901 cggcgagcag gcggtaagag cgactatgaa ccgactccag tggtcagccc tactatcggt
57961 gagagtgggg catggaagca gctacaggct cagtatgagt ggctagaccg gttcgagcaa
58021 atcattctct gtttcgacag cgatgacgca ggacgagagg cagcagacaa ggcagccgat
58081 aagcttccga agggcaaggt gttcatgatg gaaatgaacc gtaaagaccc taacgagtat
58141 ttgaaagctg ggcgtcaatc ggagtttgtc agtgcattct atcgagcccg tacatggacc
58201 cctagcgkta ttgtagggtc tgatgcactc gacgctcgaa tgtacgaagc tgttcaggtt
58261 gagaagattc ctctgccacc gttcgctaag aagctccaga aggctatggc gggaggcatc
58321 cctttgggcc ggattgtgaa tatcggcgct gcatcgggaa tgggtaaatc tactgtagtg
58381 gacgagttca ctctgttttg gatttataac tcgcctcata tgccgggtac tgtgactctg
58441 gaatcggact gcggggaata cgcaatcaag ctgctgagtc ggaaggtagg tgagaaggca
58501 gacttgtacg agaccgttga agagaaagtg gcgttccttg atcggcaccg tgatgctcgg
58561 tacgacttgt ggcacaagga agacggaagc ccgcgcttct atctgatcga tgaccgagac
58621 ggaagcctag cagccctcaa ggctcaaatc gagcaactga ttattcagtt cgagtgccgg
58681 gtgattattc tagacccgct tcaggatatt ctggatggat tgagcaatga agagcagtcg
58741 gttttcatgc gttggcagaa aggtatgact aaaagccacc gagtgacgtt catcaacatc
58801 aaccacgtcc gtaagagtgg tggcggtcag aaggctaact cggcaggtgc ggaactgtac
58861 gaagaagatt tccaagggtc ttcgtccatc ttcaaatctg gcgcagctaa cattctgatg
58921 tggcggaaca aggacgcgga gaacgagttc gaaaagaacc tgattaacgt gaagctctct
58981 aagtgccgat ggactggccg cactggcatg atgggcaact ggtactacga cgtcgagacc
59041 catacaatct gggacttgga cgattatctg gaccgatacc ctgacaagcg ccgtgagtat
59101 gaggcttgga tggctcagaa ggaagaggaa ggccgagaca cggaatacta aggttgacag
59161 aggggtgatg cttatgtatc atccctttcg tcgtttacag gaggaaagga aatgcaacaa
59221 cgatttgaaa caatcgagca atacctcgaa tggatgggaa ataacaatgt caccaacatg
59281 acttgggata tcgagtccac gggtctgctg gatgaaacgt ccatcgacta cactgccagc
59341 ccctacaaga tcaagccaag ctacagtcat cactgtgtcg tagtagaaga gcacggcggt
59401 aacattctgg cgttctacga tggccctact tacgtcttcg acggtcgaga gtacactgag
59461 aagctgccga aagcgtcttc catgctccac actgaagaag ttgtgactct caaggactac
59521 actccggtag agtatattca cctgccgctg aaagagttca agaactatgt gctcaagcgc
59581 aagatcaagc gcgtagtggc tcacaacatg attaacttcg accttatgtc gatgaagctt
59641 gtggaagata tggactttac tatcggcgtc gagcacaggg atggtggtct aactacttgg
59701 tcggcagata cttggatggg caagcaggtg gtattcgacg ataccctcgt tatctccaag
59761 acttgtaacc ctgacctgtt cggtggccac agtctggata agctgtctcg tcgcgctggt
59821 ggtgacacca agatcgactt ccgcaagcat ctggcaccgg atgttcgatt cctcgacttc
59881 gcagccgata tgctttacta ctgtatctat gacgtaaagg cgaacaccgc tgtatggcat
59941 tggttgcagg accacgaaga ttaccaactg tctgaccgcg acaactacat caagaactgg
60001 ttgtctccga ttcagttgga gaaaaaggtt gcagagatca tcacctatca ggagcaccga
60061 gggtttgttc tgaacgtgga cctctgcgaa aaggcagtga aggatttgga tgctaagatg
60121 gaagagcgtc gagcccgggt agagcctgtg cttcctcctc gtcctgcaac caagaagttc
60181 atggctgact acactccgcc tgttcgacag ttcaagaaga acggggagat caccacttac
60241 ctacagaagt tcattgaaaa gatcggcgct caattgaaag agggcgacga cagaaccatg
60301 atctttgagg gtaaggagta caagctgcct ctcccggcag acgtaccgct gaagacggaa
60361 atgcctgcta agatcgggga cacaactcac atcaagcaat ggcttatggg tgagtttggt
60421 tggattccat cagagtggaa agagactgat ctgactgtgg atcagaagaa gatcaagctt
60481 ccgatggaaa acatcgttgc taagatcgat cgctggctgg atgtaacgta tagcacagcg
60541 tacaaggaag agcggctgga cgggttcggg gattacatga agatcacccc tcgtagcacc
60601 cgcgcgtatg tacgtcagag gttgattgat cgtgcaagca aggggggctg taaggttctc
60661 actaacccta gcttcacaaa gggccaagag aaagaaatgt gtccagacct cgaacgcatt
60721 gcagaacagt ttccgttcgc gaaggatgtg attgagtacc tgacctttaa gcaccggcga
60781 agcgcaatcc tcggtggcgg catggactgg gacgaaatgg aggatggaga ggagccggaa
60841 aaaggttacc ttgcaagcat tcgtcaggac ggcaggattc ccacgcctgc tgacacttgc
60901 ggggctgcta ctagccggat gaagcaccgg aaggttgcta acgttcctcg gatcacctcg
60961 ttgtacgggg ctgagcttcg agagttgttt ggggttggag atgggttctt ccaaattgga
61021 tacgacttcg attccttgga agcacgtaaa gagtcggcct actgcgatca gtacgatccg
61081 acaaaggaat actgtaagtc actcatgatg gagaagccat tcgacgttca cacgatgatg
61141 gctaagcgta tttccgagat tatcggtcgt caatttaacc ggtctcctgc gaaaaacgta
61201 aaatacgggt gtacgtacgg tgctcaagct ggtaaagtgg caaaaaccat tggtgccgat
61261 ttgcaaacgg gtcaactggt attcgatgcg ttctgggatg cagcattccc attgaaagca
61321 ctgaaggatg acctaaccaa gcagtgggag gccaacggta agaagtatat tgttggagtg
61381 gacggtcgcc gagttcctac tcgttcggct cacgctatcc tgaacagctt gttccagagt
61441 ggcggtgtta tctgtgctaa acgtgctatg gtgattcatg accaactgct ggagaaagaa
61501 gggttgaagg tagacttctt caaggaagac tggaagaaca agcctgaatt ctgccaacaa
61561 atgatcgcgt accacgacga agctcagttg gaagttacag ctaagtcggt cagcttcaag
61621 atgttccctt ggtctcttgt aggcggtaag ccggaagggg agaaggagcg agaggcagcc
61681 gagaaggagt tgaaagctct tgctcaggcc tacaaagatg agcaactagc tgccactgga
61741 aaggtgtgga gtgacattgc acactacagc aaaggcgaag gcggggtgtt tgtagcatac
61801 tgccgtgctg gagagcttgc cacgaaggcc gtgagagctg cgggagagtt ctactctact
61861 cctctggtgc ctatcgagct gaccgctggc tacatcgttg gtcgatcttg gaaggattgc
61921 cactaaaact ggcattaagc gaggaaaggg gcttgacagg cccctccgcc tcctatacaa
61981 tggccacata ttcacaacat acaaggagaa acacaatgac tctggctttc attatctatc
62041 tggtaatgac cgtattccca gccttgtcgt cggctggtag ctttgccctg atcgtcacca
62101 tcatcgcatg ggttgcagga gggttcgttt acttggcatc cattggtggc cgagagaatt
62161 cggcagttaa agccacactc aaaaatcacc tacggccctt gacgttcaag ctgtttctgc
62221 ccatcattgt aatcggccat ctggtgcctt cgtctgagac ggcatggtgg atggtcggcg
62281 ggtacgctgc acagagcctc tatcaagcag acgctactca gcaggttctc agcgaatcta
62341 ctgaactgct cgaagctctg gttaagcggg ctaagaaaga aactctgaag gctgtcgaag
62401 gcagcagcga gtgatacggt aatcacagaa taggaggtat gtatgaacac ggctcgactc
62461 tacgtctacg gcaaatcgtc catggtagga atcactgttg acaacaaggc caatcgggag
62521 tactatacct ctaaaggctt cgaggtatcg gagacaccgt tagcccataa aagcgtggct
62581 aacaaataca aacagaaagg aggtaaataa tatgtctggt gttattcccg ggactatcgt
62641 caaactcact caagtgggat gtgacgtcac cgttggctgg ccaaaggaag cccgatatgt
62701 aggcgcatac gcagtcgcag tagatggacg cgatatcggt ctcccggaag gggaaatccg
62761 gttctgctcc cttcattggt ccattgaccg agacgtcaat gatggacttg gagactacca
62821 atcgatgctc gctgacaacg accgcttcga aattgtagcg atcccgggta agaagtacta
62881 tgttaagagc gctgccgcgc gcccggactt gatctcccac tacttggtta cttcggaacc
62941 agctttgtac gagggtttcg aaccgtgctg gctaaagagc atgcacgaag gagagagccc
63001 attctgcatg ctctttaaag gacgagttaa catcggcggt gatatttctg acgatccgaa
63061 gctccagact ctctaccctg aattggtact tgaggagttc aaagaagagg cagaggaggc
63121 tattgaagct ccggtcaacg aagagaagaa agaaaaggtt gcaaagcacg ctgtaatggg
63181 ttatgctgtt ctcgatgtag acggattccc gcttaagttc accattactc gcgaagaggc
63241 acggtccact aagcgttggt ggggtggcaa ggcggaaggc gtctcgattg tcaaactgat
63301 taaaggagag gaggtgcgct aatgcgctaa tcctcttgca gaatccggga atgtccggta
63361 tgatcgtcgg tcaagtggct gacacactcg cccagtctag ggtacttaaa taggagaaat
63421 aaaatggctt ttaaactgaa cgtaactacc aacactcaat ccggcaacgg cggcatccgc
63481 aaggaagtcg attgggatgc tctgaacaac cacgtcgtgg aagctgctgg aactgccgct
63541 aaagcacgtt cgatcccggg ttatatctcc ggcatcatcg acctcggcga gcaagagcag
63601 aacgatgcag aggttgtgtt cactggcact gccgaagatg aaatccaaat catcaaggaa
63661 tatccgaaca cttacttcaa ggatggactg gacaagcaga ctcgcaagcc tgtacgtctg
63721 aagtgctggc cgcagcgcga tatgcaacaa atcgcgatca ctgtggactt ccctcagatc
63781 gaggtagaca agagcctgta cctgaccggt aacagcaaca agtctccgct tcgtgtcctg
63841 tacaacggcg actttactct gccgggtcag aagactaaga ttgttggccg tccgttcacc
63901 atcaaggaag tgaagcaccc gaacggcaaa tgggcgttcg ctaagaactc catgctgcac
63961 aaactggctg tagctactgg cgtcatcaac gaagacgaac tcttcaccaa ggaccgcgta
64021 ggcgagcttc tgggtaaagt ggctcagttc caagttcgag tgtggatgaa gccgggcaaa
64081 aacgacatga aattcctcac cgaggatatc agtctggtcg gtatggtgcc tgaaggtgtt
64141 ccggtccctg aactggatga gaagtacatc tacggcgtga acctgtatgg tgagaacgac
64201 gaagaggcag ttaagcaact gcgtgccaac gtcatcaaca ccatcaagcg agccaagaac
64261 tacgaaggtt ctgatatcaa ggcgatgatc gaagctgttg aagctgcacg tggtggcaac
64321 cgctccagtg gggatagcga ggaacaagct gaagctaaag aggagaccaa agctgctcct
64381 aaagttgagc cggttcagac caacgtcgat gacgacattc cgttctaagg ttacgcggaa
64441 gtagaggtaa tagaggtaat agaggggctt cggcccctcc ctttcaaatt tcaaaggagg
64501 caatcaatat gcaaatcaat ttcggtccca tcttccttct ggctgctatc gtactgtgcg
64561 tactgaaatc tgctggcgtg ctcgctatct cttggaccgt ggctctaatg cccatctgga
64621 ttcccttggt gattgttcta tctgttctcc tgctgctgct tgtagttgca ggcctgattt
64681 acgcattcgg ggatcgtagt caactaaact tcgcctttaa aaagaactac agccttaaaa
64741 agaactttcg aaataagtga ggactaatga tgagcaactt ggttattgtt cgagtacctg
64801 agtacattct gaaaggcccc gcagtacaaa atcagtttag cggtgaggtg tgggaacgag
64861 agcttttcaa ggatttgaaa gaagctgcga aaagtatcat tgaaggagag ccagcttatg
64921 ttgctcttcc taacaaggta aaccctgata ctcggcaaac agagtgggac attaaggttg
64981 tgcagttcta acccaagggg agcttcggct ccctttttca ttggagataa aaatgagtga
65041 aaaggaagag gatatcgtcc tcattgacgg cgatctaatc gcctttaagt gtgcaagtgt
65101 caacgagact cgatccatca ttgttaaaaa caaattgacc ggagaagaag agacttggaa
65161 gaatcggaca acttggcggg agaataacaa ggatgaagag gggttcaacg aagacaactt
65221 cgaaattgaa gaccatcaag accccaagca cgtatcctat ggtatctctg ttgttaagac
65281 catgatcgac cgaatctgcc gccaagctgg gtgcaagcag ttcaagattc tcctatcagg
65341 ccctgataac ttccgtgacg ccatcccact cccgaaagaa tacgagatta ccaagggtaa
65401 aaagaccttc actcgtggcg gcaggtacaa gggtaagcgt acagggcaga ttaagcctct
65461 tcagctaggt cagctaaggc agtatatgat cgaagcgtat gacaccatca tccaccccgg
65521 cgaggcggat gacttgatgg cggagatgat gtataagaac ggcgtaagct actccagagg
65581 ggagaccact cagcgcgtga tcggagctac catcgataaa gacgcagatg gcaccctagg
65641 atggctttgc aactatgagc gtgagcctgt tcaagtcaag ttcatttcag gcctagggtc
65701 gctctacagg gactctaaag gcaaggtaag gggagagggt aggaagttct tctacttcca
65761 gttgctgttt ggcgatcctg ttgactgtta tcgccctgct gacctgtgtg tcgggaaaga
65821 cttcggagaa gtggcagcgt ttaacatcat taatccctgc acaacggaca aggagtgctg
65881 gcaagcaatc tacgacacct acaaatcgtg gtaccctgag cctgtcactt acacagcatg
65941 ggacgacaca gagcacacta aagatgcaat cgatatcatg caaatgtatt gtgactgcgc
66001 ccacatgcaa cgttgggcgg gggatcgggt agactgtagg gctgttttgg ctaaacttgg
66061 agtggatttg ggaggtgcag aatgagcgta agggcgcgtc cttgggagga cttcccgggt
66121 atctggaaaa ccgaggcggc gttcttgagt tgggtcagag gcggcattcg ccgctacctc
66181 tggtctaaga acccagtcaa gcttgagttt gctaaatccc gaaggatcaa gatagccaac
66241 accaatgaaa aaagcaagct cagaaatccc actgtatggg gctatgtatg cgagcagtgt
66301 ggaaaggaga ctcctcaagc taacgtcgag atcgaccaca agacaggaga attctccctg
66361 aagcgagtag aggatatcca atcgttcgtg gaaggtgttg tatttgtccg aatggaggac
66421 ttagctgtcc tgtgtaagcc gtgccatgag atcaagacct atgcagagcg ttacggactc
66481 accctcgaag aggcagatat cgtaaagcag gctattgcaa tccagaagca aaaggggtat
66541 gataaagtct tcttgcagga agtgggaatc aaacccgcat ccaacgcaga gcttagaaaa
66601 gagcagatca ttggatacct taggtctaag aaggagggtg gatgaacgag gatcgggttt
66661 acattgtagt aagagacgag gcaccagaat acatggtgcc tactctggtt gcacatagca
66721 tcctaggggc agacatggca atggttctcc tcggacagga ccgggccgtt ccatcgacgg
66781 accttccgtc ccgtccgtat atgcatgcag cggcaaaaac cgccattaag tgggtggagt
66841 ggaaacagtg gagcttccgt aagatcgttg tacgagtttc tgacaaagag tacaataaga
66901 tcaagcaaat ccctttcgta tatgagggat atgagaaaac catttgcaaa ggagagggtt
66961 cttgtctagt agtgcctcct cttagcaagg aggaaacccc gaatgttctt aaatttgcaa
67021 aactatggag gcctatgtga gagaggagtt tattaaaatc atgcgaaagc tgccaatcag
67081 agtacgagct tctatcgtcc tgatttggat tgctctgttc ttttggctgc cggttgtaac
67141 agcgatcgtc gccggagtta tagacttctt ctataccgca aaggatcagt tggaagaggg
67201 atactcggta ctcatttccg ctgctaaagg agccgttaaa tgtcttcgta caggagagga
67261 gctatgacga gtcttgctac ttatgttatc cgccataaga aaactaagga gatttggact
67321 actcctaaag ggaagcggca atgggcaaca aaaggggctg cggctctagc ttggagaaac
67381 gcctatgagg gaactacact gggcgtatgg gctgctaaaa gggacatgga gcgatggtcc
67441 gacttgaaca ttcctatgat agtggagaat gggtgctacc gtttggctag ccgagaggcc
67501 gcagctttca agagtcaatc tgctttcgag attatcgata tagctgaatc tctgaagaat
67561 gagaatcaat tggtactcga cttgctgaaa gacgttatcg gatttgaagt gccagactcc
67621 gttggagacg gatacgttcg tctaactatt aaaacatcca catatgatga tatcatcaaa
67681 ctactgaagg agacgaaatg agcatgatgg accctaaagc atacttcatc aaacaagacc
67741 tagaggaagc cacaaaactc ctagaaagag cttataatct ccttgataac gtccactgct
67801 atgatacggc tgtgtatgag gatattggag catttctgta cggacaagat tgcgaggagg
67861 tagagtaagg tgagaatcga ccttaaagaa gccacggatc aaataaaaga cttgattgta
67921 gctatcgctc tgctagatga agtccttgtt tggatggaga gtgaagacct gtgcgatgca
67981 gatatataca aacgcatcga cgcatttttg tactaccagc cgggagaagg cgaatgggag
68041 gaggtagaat gagcagtaag aaacactttg taatttctga cactcagtgc aaaccgggta
68101 tcagcttgga ctacatggaa gccatcggta aatatatcgt agccaaacgt ccagatgttg
68161 tgatccacat tggagatcac tttgacctag ccagcctgtc gtcctacgat aagggtaaac
68221 gctcctctga gggccgtagg tactctgaag acgtgcaagt cggacgtgag ggtctggacc
68281 gactgttcaa gcctctgtgg gagctacagg aacgtcaacg ggctaatcgg aagaaagtgt
68341 accaaccccg actgatcttt acactgggta accacgaaga gcgagcagac cgggctgcta
68401 atgacaaccc tgagttgtat ggcaccgtag gcagcgatga gcttggtatt caggactacg
68461 gttttgaggt tgtcccgttc ctcaagccta tcgaggtaga cggaatttac tacgtccact
68521 acctgcaaaa ccacttcact ggtaagcctc tgggtggtac agcgaacaac atgctcaagg
68581 ctgctggtca ttcgtttgtc atgggccacc gtcagcttct ggactgggcg atccatccta
68641 caatcgacgg aaaacaaaga cttggcattg tgactggagc gtgctatcct cacgatgaag
68701 cctacaaagg ctatcagggc aacaaccact tccggggctg tgttatgatt cacgaagtga
68761 aggatggttt tggtctgcca atgccagtaa gtctggactt catgatggag aaaggaggtt
68821 tcaaatgacg gtttataaat tctggtgcga atgggatatc ggtattaatg aatgcctgtg
68881 gcgagactac taccagatgg aagaggatgt agctaaagcc ttgtcagact gcgggattga
68941 ggatactatt gaggaactag agggtgcagg cctgcttggc ttcgactctg ttaaagtgat
69001 tggttaatag gagggaatat ggctgagttt ttccttgggg cggcccttgc aggcttgttc
69061 tttatgttta gtatcactgc gagctttacc gccgaagata ttgagaaagt gacttcaaca
69121 tgcgagaata acgaaggcgt caagtatttc ggagttgact tcttcggaga cggtgctgta
69181 cactgcaaca gcggcgctat tttcaaaatc gaccgcaaat ctaaataatc gaaaaggaga
69241 tataaaatga ctgatttcaa catcacccct gagcaaatgg aagaagcaat ggcaggtatg
69301 aacccggagc agcgggctct ggtagagaaa gccttgaccg accgtaaatc tctggaagat
69361 tccatcgtga ccgaggacgg tgaactggac tatggcatgc ttgcacgaca catccgcacc
69421 agcttgggtg atctgcctct ggtaatgggt ggccctgact tcctgaagct gatgatcttg
69481 gttgctgcga tgccggagac caaagacgat ctcctgactc tgcacatgaa cctgtccttc
69541 attctggact gcattcgtga atcgattagc gacgaggagt aacaagtggc cgaagagatt
69601 gtaaaagaag acctatctgg cgacgatctc atggttgact cagcagggct agatgccctg
69661 ctggccttcc tagagagtca gtttaaaggt ccgaagggtg tactgaaggg atatgtcact
69721 atgagagtga tgtgcgctaa gatcgagagt cttgacgggt ttcaagagtt gaaagatatg
69781 gaggtgaact ttgagtaacg atatcatcga cgttcatgct gggcaaccga tttctctggt
69841 gcaacggtca aagaatccta tcaatattca atattgggac gccgatacca tcccttacgg
69901 cacagtcttg gttgttaccg aggaaagggg tgatatacga aagggagaat tggtcgtaag
69961 gctggctagt agtgcagatg atgagcactc tgttaaggta tgtagattct ctgatttctt
70021 cctcctaatg gagaggggct acaactcagc tagccttagc gacgtcagtc aagcgtatga
70081 cgttctgttc gaagaccctc cggcgactac ctttgtcaac tgggatcggg ctcagccttt
70141 gacaaacagt gagcgctact acggagactt tctgattggc ggcgacccta aagggatgcc
70201 actattcaac atggctgttc ttaaaaatgt tctgtcgcct tacactgccg acgatgagga
70261 actttcagct atgtctggga atcccgagac agtagagcac aaagaagttg acgaactaag
70321 tgagagggac gaggctttag ccgaggtcga cagactcaat gaagagcttg ttgcactggg
70381 taagaaggtt gtgttcgcca acctagaaga ttacctaggc aaagaaaact atgccacatt
70441 ggaagctatg gctaaccaca aggaggctgt aggtagcgga ggctcctcta gttactacac
70501 tgtcaaggtg aacaacccca ctacgaaggc taacatgccg tattttgcag agtgcaacga
70561 tatcatcgaa gcgctggata tgcgattcgg tcaaggcaac atgttcaaag cgttgtggcg
70621 ggctgcggca gcacagaacc taggcaagct gaaggccggt aacgatgtta tccgggacta
70681 cgagaaagtc atcttcttcg ctcagttgga gatcgataag attctcagag aaaggggttg
70741 acattctccc cgaggcttgc gataataggc tccaagttga aacgaaggag gtgtgtagat
70801 atgatccaga aagtaaaaca gaagctcatg atggtgcatc ctatcctcgc tagcgagatc
70861 gtctggtgcc tcaccttcgc aatgcttcag taaaacaagg gagcttcggc tccctttatt
70921 gtatcaaaga tttaataagg agagtttatg caaatttctg caaaagtgat tcaacacagt
70981 tcccggatcg gcctaggtac gaagaatcac agattcatca ctacattcga actggagtat
71041 cctcggttta ttcacagtga acttatgact caccgacttt ttagtcgaaa tgctgcaagt
71101 agtcgtgcca ttcccgttgc ccatatgatc cgacaggtgg aagagaatcc tgcgatgcct
71161 gttcactggg gaatgaatca accgggtatg caagctgagt tcgaactgag tgagtgtttg
71221 cagcgtagct ctcagtacct gtggaagaag gctgcaaaga gtgcggctcg gatcgctagc
71281 gcactaaata aaatgggact ccacaagcag gtggttaacc gtctccttga gccgttccag
71341 atgatgaaga ccgttgttac agccacggaa ctagataact tcttctacct gcgttgccat
71401 aaagacgcac aaccggagat caaggttctc gctgagaaaa tgtatgaggc tcttattaaa
71461 gcgggcccgg cagaggctct atatgacgga gagtggcatg ttccttatgt gactcggttc
71521 cgcatagggg atggtaagct gcgttacgca gattgtaacg ggcaagaact gagcgtagag
71581 gatgctatta aggtatctgc tagctgctgt gctcaggtta gctataggaa gaacgacgag
71641 actctggaga aagctcttgt aatctacaac cgattggtag atactaagcc cgttcacgct
71701 agcccgtttg aacaccaagc cacgccgatg ttggagcctc acttctggtg cggggattgt
71761 caacaacagc cggattggga ggatggcgta acgcacgcgg atcgcgaggg gaatttctgg
71821 tctggtaact tcaaaggttt catccaacat cgtcaactaa ttaaagggca cgtatgtaat
71881 gagtactacg gccgagaaga ggaaggagtt taaaatggca gaatataacc tgagtctgga
71941 agacctcatg ctggtagatg gcttcaaaga ggcgttccag agtaataatg agaagatagt
72001 gcgggagcat ctgtggacta acggcatgga tgttaaaaac tactcgtatg aaatggtttt
72061 ctgtcaacat cgcacactga ttggccgggt cgtagagggt ctacgattct ctggctttga
72121 gcggacagat aaagagtggc tgagcctcgg ttgcgcctct ctggaagctc atattgcagc
72181 gtgtgatgat agtaatctac ggttcactct tcgtaagatg cgaccagagg gatcgacaga
72241 ggcaacgttc cacaattaat gcagtaggag tagatatgga agttacaaag gctctcgtag
72301 atgaggccga tattttcaat aagatcacac aaatcaggac tccaacggag tcctatgccc
72361 ggaaataccc ggtcattgtc gaactagcaa accagcaact agaagagaag ttgtggttct
72421 ctagcgaaat gaaggtagag ctggataagt tgaacctgaa gttcaagttg gaacctcatc
72481 agcttcacgc tgtaaagact gtccttcaac tgttcctcaa atacgaactg atcgtagggg
72541 aggagttttg gatgggtaaa gttgtccgca cgttccctcg cccagaggtt aaactagcgg
72601 cttcgatcct gtgcatgatg gaattggcag tacacgctga attctacaac cagatcaacg
72661 tagtgctggg gatggataca gatgcggact atgtagctta caaggatgac cccgagctta
72721 tgggtcgaat ggattggcta gaatctgtcc taggtgatga agatgatgtt ctttctgtaa
72781 ttatcttcag cctaacagag actgcccttc tgttcagttc cttcgctatc ctgaagagct
72841 tccagtgcaa cgggtacaac gatatccctg tgatcgcacg cggggctaac cagagtgctg
72901 tggatgaaga cttgcacggt gtagtttcgg ctgagatcat caaccaatac tacgcagaga
72961 ttggtcgacc actgtctgaa gatactcggc gcgtcgagaa gattcgacag gctatcgacc
73021 atgtatatgc tcatgaatgt cgtattgtcg atatggcgat cccgggcgga gaacttaacg
73081 gcgagtcggc tgaaaactat aaagcgtttg ttcgttatcg tttgaacgta tggtgccgtc
73141 gtctgggtct ggaagatcat ttcgagaacg atgacactcc gatcaaagat tggttcgaaa
73201 tgaacacgta cgcttacaaa atgattgact tctttactcc gggaatgggc atggaatacg
73261 aactggggtg ggatgaagag gaactagcaa aggcttggga agaggagctg aaatatgagt
73321 aagagagaca cattcaacta ttccgaagct aggaaaaaca gtcaagcagc aggagagact
73381 cctctgtggt atacgacggc tggctaccag ttgttcatga agaaatattc gaatgagggc
73441 gagtctgttc gctctcgttt tgagactgtc gctagagcta tggctcagca cgctcctaag
73501 gtgtatcctg agtggtggga aaaggacgaa tacactagag gcaaggattg ggagcaggta
73561 ttcttcgatg ttatgtggga cggttttgta agcccatcca ctccgcttct gtcgaacggt
73621 gggctccgca agaagggcac tacggtatcc tgtgcaggcg ggttgatgga caacaacctc
73681 tatgaccgtt acaatgtaat gacggagatt gcagtgctaa cgaagcatag tcacggcaca
73741 agcttcagcc tgaccaactg gccatccgaa ggcgatgcca ttcgtggtgg agagtcacag
73801 ggtgttatgc ctgtcattcg tgacgttatc aacgtcatgg aagaggtcgc acagggttct
73861 cgtcgtggta gctgtgccta cagcattaac ccccgccacg gggacttctg gaacgttatc
73921 gatcacctgt acaagcgtac agaatcgaac aacgtcggat ggttgctgga cgacaattgg
73981 tgcaaggcta tggccgagaa agaccctgaa acgctgaaac gatggaagcg gatgatgttc
74041 gttaagctgg caagaggcaa gggctacttc acgttcattg acaagatgaa ccggcacctc
74101 gcagagccgt tcaagcgagc aggtctgaag gtagaggcat ctaatctttg ccaagaaact
74161 gtgcttccag ctaatgactt ctacacattc agttgcgtga tcctaaacta taacctcgaa
74221 ctctaccgtt cttggcctga gcatctagtg ttcatcgggc aggttatgtc ggattgcaac
74281 atcagcgagt acctcgcaac catggacgaa gttagcattc aggaccgaag ggctctggag
74341 aagatttacc ggttcaccaa ggacttccga gcacttggta gtggggttct aggattccat
74401 actctactcc agcgggaacg attcccggtc ggcagtatgg acgctatgtt cctgaacaac
74461 gccatcttca aagggatgaa ggagcaagcg gaagcttgta acagttggct agctgaggtt
74521 ctaggggagc cagagggctg ccgtggacta gggaggcgta atgccactac aatgatgatg
74581 ccgccaacta aatcgacggc agaactcatg gctggggctt ctgagggcat cggactggac
74641 gttgctatgt gcttcaccaa gcagagcgct ggaggtgaat tcttccgtgt caacaaggtg
74701 ttgctggaga ttatccaaga gcgaggcctt gattgggaag agtgtgcaag gcagatcaac
74761 gaacgcaagg ggagtgttca gcacgtagac tggctgacag atcacgaaaa ggctgtgttc
74821 cgtactgcct ttgaggtgag aatggaagac tacctgcgtc tgtgctctca gcggcagaag
74881 tacatcgacc aaggtcagag catcaacctg tacttcacgt cgaacgactc gccggcttac
74941 atttcgtaca tccatcgtct cgccatggaa gacccgaaca tcctatctct gtactacatc
75001 tacagtatga gaggagcggg agatatctcc agaacagaag aatgtgaaat gtgcatgtaa
75061 aatcattggc ccggggcttg acagcttccg ggcctttgtg tattctgagc acatcaaaac
75121 aaggagggac taaaatgaac aaattctctg aagtgtacta cacttggagc gcagcgtgct
75181 ctcgtacaaa tatcttgata gatatgggat ggactgctac aatccgtcga gacttcactg
75241 gcgggatcaa ccctgtatgg gttgtggagt tcacgcgatg aacagcaaac tccgcaaaga
75301 gttcgataaa tggtggggac aggacgagca agaagaactt cgtaaatcct gtgccaaagg
75361 atgggcggaa tatatctgga tggctagtcg aagaaaagtg agtgttgagc ttcccgcgcc
75421 agaaggcgga tttatcgaca tccaaaagta cacaatcaat cgctgcaaag aagctatccg
75481 cgaaacagga ctggaggtgt tttaatgaaa gaatatttta aaaagcgact aatgcagacc
75541 agtgaaccgt tcgattcagc gacgcaagct atggacgtag cgattgcgtg gggaggggct
75601 aagtactgcg aattcacttg cgtaactgcg gataatcgcg tcatcagcat ctgggagtac
75661 aatgacgtag agcctgataa accggtattc aatggacagc aacgaatctt agttccaact
75721 tttgaggagg tagtataatg gaacaaacta ttgataaatc tcggtatatt gtgcttgata
75781 acgaaggtcg gcacgttctg accttgtgcg agaaggccgc ctataacctg cttaaaggcg
75841 ttcagtggac aaaggacaag catggtcaaa tccatgtaaa tggtgtcaca ggcgttgaac
75901 tcggagttcg tcaagggatt atcgctgaag tattcctgta tccgggctac atcatcctag
75961 aagaggtaga ctaatggata tgttcgataa atacatgcaa gttatgtatg accgggacgc
76021 tttctcaagg cgagtcggtg agttagaaaa agaggtagcc gaactcaagg ctaaggtggc
76081 tatcgctaag tgtgatatgc gtgtcgtgaa aaccctactg gaagatatcc aatgggtgta
76141 tcaagacgaa gctatctata ctctaccggg ctacgtttgc ccttgttgcg gggaatctgc
76201 aaactatggg catttccaag gcagcttcga taagagcccc tgcctactag cttgtgtact
76261 gagccggagt gaagcatatg aagcctaatg ttgtagactc gctaggcatt aacatgtgct
76321 acgcctgcgg aggtaaactg tacgtccgag gagtatgcac tatctactgc cctgattgcg
76381 agaaggcaac gaaagataaa ccgttcgtca ggatgcagct tctacaggat atcgaagaca
76441 gcaagagggt tgacaacgaa tagaagtgct agtaagatgg ccacatcaga cagaggagga
76501 gccatggcta caacagagaa gatcatcgag tatgtctcgg cctgtatcga acgcttgcaa
76561 gaggacgtaa ctgggtactc ggagaacttc cgtgacaggg cgttatctaa tcgcacaggg
76621 tatattcacg ggcttatcac tatggctgaa atgaatgagc aggtgagtat cgaggactgt
76681 gacaagctcc gtgcaaagct tcgtgaagct gctgaggctg tgttgaacgt actggattcc
76741 aaaattaact aggaggtgtt ctgatgaata tgaaagagat tgtgcaggct ttgattgtcg
76801 ttgtcgctct gactctcgca gcaataggtt ttgtagtcgg gattactgcg ttggccaaca
76861 agagcgcgcc cgccgaggat attgtcgtgt ctactgaaga cggcaccatc aatctcggtc
76921 gctccgtgaa gagcgagaag ctgctgtata gcatgtgcat caaggtagaa gaccgcaaac
76981 ctgcttgtga attcaccacc aaggaccgtg ttcttagcga agtgaaacag gttatgcgcc
77041 cgggcgaggc tacggcccgc gatattaaga ttgcagtaaa cgcggctgtg acgtatactg
77101 gtgagaacgg gcaggaagca acctctctga ttaccccgaa aggtaagtat ctcccggctg
77161 gcaccccgtc tgaagtacat attcaggcta ttgcgaatct gttcgacagc gtgtacaatg
77221 actacaaaca aaacttcagc aagatgtgag gaggactcat gaaagcacag cctaaagaag
77281 tagaaaccct gtccctcgac aagcgcccca aggcaggtga tgttgttcga ctgcgatctg
77341 acggtaaaac ctacgaggta aatgctgtat atcccacggc agtgggctgg gaagcgattc
77401 tccgcaacat gtacgacaag actaagaccg tcactgtcag catggagtgg tgaaatggca
77461 agaaccgtca agtgcgtaaa cttcctacct gtcactccgg acggtcgagt aatcgtccga
77521 ttcggcaaga agaggctagg ctggcttggg aaacagggta agaagtggca ttactaccct
77581 tacggatgcg aaggcaagat taaatcagag gggtttaaga cactcgccga gatcaaggct
77641 tggattcgag acccggaggc tgtatggccc ggtccgcagc ctgagattga ctaattagcc
77701 gacgaatggt acaatggtat gtaggaaatt ccctactcaa tataaggaaa ctagcaatga
77761 ctagccgctg gaaagaggcc gtgtatcgta agtactcggt gcgtcgtctg cggcaggaac
77821 tcgaagagtt caaagaagct agacgctttg caccaaacca acgcatccgt gcatggtttg
77881 atgctcatat cgaatttcta gaacgccact tggctattcg agagtccggc caagcctacc
77941 cagacgacct ttggtaatta ggtaattagg tgtgttgtag gtagagattc aaatcatggt
78001 tagtggcaag gacgccacac ttcagcccgc ccacaaggcg ggcttctttt tgcctgaaat
78061 ttgcggttga caaggttggc cggaatatgt aaacttacgg catccaacag aggagggaag
78121 aaaaatgcaa ttcaatatat cgaagcagct atgggtagct aaaagcgagc ggaagggcga
78181 ctataaaggg acgcttttgg catacatgtc tcaagtggac ttcaataaag atggtagctt
78241 ggctgccagc ttcaagaaaa agcagcagac tggtatgagc tgggcaggta agaatgccga
78301 gacttgcttc atagacaaca tccctatctc ggggcatttc atcggggaca gtgttgaacg
78361 ctgggtcact gagaacaaat atttccgtgt gacggaccct aggggctttg ttctagaggt
78421 tcctaccggg aatatctcga cattgctcta caactgcaca gtaatcaagg gagttattca
78481 agaaccttgc gtgtgggttc ggatgggctc tcagcacgtt ctactgccgg aaggctcctc
78541 tctctacaaa gaagctgtaa gtttcgtaga gcgaaaagag gcggccaaaa ctgttaaaga
78601 tatggttgca ggggatcgat gcactcttct tagctacggg acagaggaga aactagaggc
78661 tgtctacctc ggacaggtga agatcacttg gcacctccta gctaaaaagg gccggtactc
78721 tagccgaggg tggggtgggg gtcggtgggg ttaccaccat ctagagaggg aactagatag
78781 aaaagaattc actgagaaag attcgaagtg ggttagtgtg ttcgctaagc cggtaggaaa
78841 gcggtggagt atccatttta tcctgtctcc aaaggcaacc gacattcaat ctggaaatgt
78901 accggatgaa cttcaaaacc tcgacctagt gaatggtgta aaatgggagt acaacgagaa
78961 agacgaccgc ccatcttcct attactctgt accggatagg gtagttaagt gtatcagtgt
79021 ggatgatccc ctgtgggata agccgcacag ctcttcggag gtgcggtgga cccgcgaatg
79081 gaccgtggtc ggagcagagt ggcgaaaata agccaccatt attttagaat tgcccggcga
79141 gagccgggct tttcatggca tgggttattt tcaaattatt tttagatttc tgggagtttc
79201 ggccaatatg ggcaatatga aatttctcag gaaaaggctc agaatgctcg tataagagcc
79261 gttcgagtgt aggtatggtg agctactact tagccgtaga aggacagtgt agcgcttaat
79321 aggaggatta aaaatgaaga ttgacaacgg tagcgcgtat gcgtattggc tagcggatat
79381 gaaagagttt gtttctcaga tggatgccac agagattgag aagagggctt gtatagcata
79441 cttaattagc tggtatcagc gaagagtact gcacagaatt aaacgggagg agtacgaggc
79501 gatctaagct aggccggaca gatttttagg gactggatag attttcacag actgcaaaat
79561 tgagaactgg gcagattttt aggaactgga cagtttttca cagaagggga tttttctaca
79621 gaggaatttc ccctgaaatt tagccggatt tctcagaagg gcggatcgtt agcaggctat
79681 ctaattggtt agcaagctac ctttaatcgt tagcacacta actaaaaatt cctaggacgg
79741 acctcagttg gcacgaacgt tgcaagcccg caccagtttc ccgggcaggc gtaggcctcg
79801 actatccgtc gtgaaggcga tatgtagttg gggactcgca ccccgcgttt aagatgtgcc
79861 cattctacta tgacaaaccc ctttgtcaac ataattttta tggcacagtc tttgcaattg
79921 caattagcgt gccaacctaa atctcaggct ccctccgtgt ttgcctccgg tgctcggcct
79981 cctgcctgcg ttgcccgcct gcctgtcatt atacacaagc aagaaaagaa ggcaagcgaa
80041 aatatagaga aaaatctaca taaaataggt tgacaggctg tctctatata ggcacaatga
80101 gccaacattc aacggaacgg tactctacaa tgttgcacaa tgacgcccgg gaattggccc
80161 tacaggaaat ggacaaatgg ggtctcctca aacaaggctg gaaattcaga ttcaatagta
80221 agctgaaggc tacattaggt cgatgccatt atactaaaaa gctcatagag ctaggctctg
80281 attatgtagc taacaacggc ttgcctgctg ttttggatac cattcgccac gagatagccc
80341 acgccaaagc tggacgaggg cagggccacg gcgcggtatg gaaagagtgg tgcgaattga
80401 tcggggccaa accgaaccaa tacgccagca ctaaggaaaa ggtagtcgtc tatccgtggc
80461 gactggccat ccatcacgga ggcggccagc ttgaactact caaccattac ggtttcagac
80521 ggactagcat ggcgagaaaa caggtacgtg ggcgtcctga aacgctgggc aggctagttt
80581 gggtgaagaa cgaagacgac agaaaataat gcttgacagc ttaggccatt cgcgtagaat
80641 ggccctcaag caaagggaat taccctgagc aaccataaag gaaagcagat atgaaagctc
80701 tttgtaatca tcgggcactc tacgcggctt acaatcgtag cgagcttgat cgcattgcgg
80761 tagacttgaa tcgttatttc cctatcgaga aagatgacga atgggaagac ggagcataca
80821 tgtatcgccg ccgcacctat ctggtgaagc attcgaaggg tacagcccgt tggcacagcc
80881 tttactgcaa tgggaccgtc caaggcgtcg gggttatctt tgacgcgaag tcggacacac
80941 gctctttccg cacagcataa ggagattcag aaatgcaagc ttggaacgta taccagaatg
81001 gccagttgat cgacattgtt ttcttcgata ttatgtgcgg taccgaggag gtacggaaat
81061 cgctggtcaa tcacgacgga tatccgtctg atattactgt agaggaggcc gagtgatgga
81121 tagcctttct gttaaaatcg ttctgtcgga actgagttac aaggcactga ttcaagcctt
81181 cgccttgctt ggccgaacgc tcgacctaga cgaggggttg gacgatatac ttaatctcat
81241 cgcggatgaa atcgctttcc gcgacggcct gccgcctttc gcagacgact gcgataaaac
81301 agaatggatg ctccgtcgat gggaatcgct cccggtggta tcgtacaata tcgggcagga
81361 cggaccgatt gtcgctcggt ctatcgaagt aaaaacggca tgagggggag aactgatgac
81421 cgtcagagta ggagatatcg tggctatccg gggcgacatt cggaaaaagc tcgacggaac
81481 gtgccaatac acgcccgaac aattggtagg tggtaagttc ctcaagcatg tcggcacggg
81541 agaaatatgg actggccgag tgagtaagat acaaggtgat atggccaagg tgggaggggc
81601 ttggcgcggg atcgaattct atgtgctcat tagtgaaata aacgcttgac aacctgaccc
81661 actagctgca aaatagcacc cacagacaac gaagacgccg ataggcgagg agaaagcaga
81721 tgcaaatgtt tttcaaaacc cgtacccaag cccgtgcaat ggccaccaat ggccgtaaag
81781 tggtagacaa cggcgctcaa gctgaaaagc gctgggctgt caagctgaac aaaaaggagg
81841 ctaagtaatg gctaagtctg ttagcgtaga ccgcaagcga tccattctcg acgaagcgaa
81901 ggatggcagt ttcttcagtg tggagtttat caaggcggac ggcaccgttc ggaaaatgac
81961 gtgtaaacgt cagatcaagt cggcgtatgc taacggccag tttgctaccc gcaagcccac
82021 cagcgctggc aagccgcacc tgtataccgc cgccgaggtg ctgaacatgg aagagggtaa
82081 atccgctttc cgcactatca accttgagac tctgacccgc gccaaggtaa acggaatcga
82141 atataaattc gattaaaagc ttgacagcct aggccattcc tgtagaatgg ccctcaagca
82201 agacaaactt aaacagaaag gagatttaaa atggcacgtt ctatcaaggc ttccgacttc
82261 gattccgctt accagttcga ggccgccaaa cgttccgaac gtaaagagtc ccgcaaatcg
82321 cgtgacaatc gcaaagctag ccgaggccga gctttcgact tccgcgacga tatgtaaggt
82381 ttgtgcctag ccggtgggcc gattcgccgg caatcctaag cccattcgtc gagtggtttt
82441 aggattctca accccagcgg agataccaaa aatggttcgt caatgcgtac cctgtcccga
82501 tgctcgccat gctttttgcc ttgcatggtt gttcgccatg ccggagttcg ccggtctgcc
82561 cgctcaaaag gacataaaac tctttaagac ttcgggacag tgggcggtat gttatggcta
82621 gacgacagcg gctcccgtcg tgggttcaag accagaccga ggatgaaacg ccgctgaggg
82681 ataggataga cccctacctt agcaagcttg gcgaagtcga taagctagag ggacaattgc
82741 gacgggtcag ggatgcaacg gacccggacg aatacaacga aatggctaag gtactaaaag
82801 cccgacgccg gaagataatg aagcaacgtg cccgggccta cggtctgcca gaggatgagc
82861 ctaccaatgt ccaagggtac agcgtaccgg aagaggttca ccgtagagcc atcctgttaa
82921 gcagtgtaaa accttggatg ttctggacca tcctgtcttt ctcgattttt gtgtggtttg
82981 ttttgaaaaa cagttgacaa ggttcccgcc tcctgtagaa tggtcagcaa gaaaggcgga
83041 caggccgcct agctagataa aggataaccg tcatgcactt cgttcttaac ctcgtttcca
83101 aaaacagcaa aaccggtccc atgcctgtta gcacgtctca taacggcacc tgcccggatg
83161 cctgccctct caaggctaaa ggctgctatg ccgcttatgg gcctactgct attcactgga
83221 aaaagctaag caagggtgaa cgtggcgtag agtggaaaga gttccttaag caagtgcggt
83281 ctatctcccg tggggatttg tggcgtcata atcaagctgg cgatctcgtg ggtcaggatg
83341 acgttatcga tgggatcgcc ctgatggaac tggtgaaggc taacaaaggt cgtcgcggct
83401 tcacctatac gcactacccg atgaacaatt tcatgaaccg ccagcacgta ttgtcggcca
83461 atcgtagcgg cttcactatc aacctgtcgg gcaacaatgt agcgcacgcc gatgaactgg
83521 ccgacctgaa catcgcccct gtagtgacta ttctcccgat ggacgcggag aatgtaagct
83581 tcacgccgaa aggacgtaaa gtggtagctt gtccggctga gaaaagcgac aaggtgactt
83641 gtaagtcgtg cggcttgtgc caagtggccg accgggagta tattatcggc ttccgtgccc
83701 acggcacagc aaagaaaact gtcgatctca ttgctaaggg ttaacacaat ggacgaatct
83761 gtttacgcac cattcaatca gtgtaagatg atgggcctag aacgaaccgt gcggagccta
83821 gcggctccaa acggatgcaa ggtagtcttg tatcaggatc acaagaacaa gcacagaatc
83881 gtcatatacg atgccctagg gcagggaatg tccggggtca tggtgcaagc ggacggggaa
83941 attcattaca aggaaactcg caaggctagc caagggcaga atctgacaag gcagctacaa
84001 gctcagctaa ccgcatgggg agtgaagtgg ttcccctctc agtatcagac agcggcgggc
84061 gcggcctgct acaaaggagg cgagtgatgc ggcagcttaa caaatcccag cttaaggcct
84121 tggggcctaa gatcgaccta gccttagagc tagcttctac tggccgtggt ggtctaatga
84181 atggccacgg ctctacctgc tacattgcaa acaaagccgg gcataacatt ctgcgggtta
84241 gctaccataa ctcccgattc gttgcatatg gtgctgagag tgtccgggtg actgggaatg
84301 tcattgcagc atgggtggaa tggaagggca ttaaccgggc tgcaatcaac gctctgagtg
84361 agtacgggta tcatcctaac ctgagcatag ggcacaacga tgctcttaag actctgcgtg
84421 atatcgagcg ttaccagtga cggcctctta ctcgacagag aaacggggcc agaggtgggc
84481 catcatccgt actgagcccg gttacagagg tgacaaggtg accgtgctag gattctgtat
84541 caatcaaacg cacgctctta aaacggtagc caaattccgg gcttggcaag cgctgggctg
84601 gccctacaca ctgaaagacg acagaaaata atgcttgaca gcctaggcca ttcgcgtaga
84661 atggccatca agcaagacaa accgcccatt aggagactca aaatgaaagc tgtagctcag
84721 ttcaaaagtg aagactacgc aagcggtgat agccgtactg ctactgtcta tgaggatgtt
84781 tatggctgct acatcgtgag cgttttcgga actagcctta gcgagcctat tgccttccat
84841 tggggtccgt tcgaggataa agaatccgca agcgatgccg ctaagtctac tatctgacca
84901 aaaaagggcc gcagaatgaa aatctccgct attctgaaaa ataacctgaa gttttacaag
84961 aataattcgt tcatgtgcgc tctggcgttc gataatgtgt ccagaaataa agctaccgag
85021 gtacaagaat ttatccatca gctactaggg cccttcgtta ccttgcacgc taagctcaag
85081 aaagagatac cgggttacga aagagccgta tacgatgatg agccagagga tgaaatgact
85141 ttctttgtat cggatagggc ctatcaaatg cggcgcttgt ggtgggaaac tgtaatcgaa
85201 caactagagg aacaagggca atgactcaag ctaactggag caaaggcgtc cgggttgtcg
85261 gcggaaagcg ggacggtgag atcacactat tcaccgatgc ccacttcagc gaatctatgg
85321 gcctctgcgg tggtgatccc gatttgatcg aggctctgcc gatgcctgct gcactccgcc
85381 tgctggtgaa atggaacaaa ctgtgccgcc aaatgaagct tgactatcgg tacgaactac
85441 tgtaatctgc aatctccatc aaaacaggaa tgctccaatg tcgatcttag ccttaactct
85501 gaccctttgc tctgccgttc aatgtgatga ttacattatc gatcactcgc tcccgggaca
85561 agccgcagag tgtaatgctc ggctggtaga ggaggccgag gagtggggcg acgcatgggt
85621 ggcgaccaat gccgacgccc gactgacccg ctaccttagc cggttcaata ttcaagttga
85681 ccctcgcttt gttttcgact acgattttac ctgccaactc attgcagagg atgaactacc
85741 atgaacgcgc cccatctttc cctcaagcag taccgtcaac gtgccgctgt catcgtccgc
85801 cgagtgaaat actatgaaag gcgctggctc cggaccgtag agtttttctc aggtgctgcc
85861 gctcagaaca tcgcagaacg ctttgcctac gctgggcatg ctgaagagca aatgaccaag
85921 ctcaaggctg agtttgcagc cttcccggtg gaggttaggc tagatgctct aggttggatc
85981 aattggaata ctcacaatga cggcctgcta gaggagtgga ttcatcagga aaccgaccga
86041 gccatcatga tcgaatatga cgaaaccacg tggcgtcctg tagcttgctg ggaaaccact
86101 gtcgatgctc ttcccaagct ggcaatgctg taaaatatcg cccgttaggc tgaaataatg
86161 cttgacgggc gtttttgtac ctgtagaata ggcctcaaga aaggaaaaca gccgaaaggc
86221 tcaatctgaa acccggagat cgataaaatg ctgctagttc atggaaccac tgcaaaaggc
86281 ctgaaagcta tcatgaaccg tcgaggcaag gagggattgg ccgcaccttg ggacgtttcg
86341 gaccatgacg gaatgtcata cttctacaac gtgaacaagg ctatggaatg gcacgatgaa
86401 gaagagtatg ctaaagcgga atgcatcgtt cgttgcctag aacaggctca attacagcaa
86461 gctatgatgg ccgaaggcgg taaaatctac gctctggttg tcgatatccc cgaagagttt
86521 caggaccgcg tagaagatga ttattcgtgc cctaacgcca gtaatgaagc tagctgtttt
86581 ccagaggata actttgatcc atcatggatt gtagaagtgt atgaggcgga ggtgagtgta
86641 tgggccatcc ctttcatcgt agctggagtc tcaggtaatt ctatgttcca atcccaccaa
86701 ctacctgaca aactggtggc gatagcggag tcggtggcgc agtccagtga catagacaca
86761 tacgaagctt tcgagatcga ccattcgcag ctcccgctgt caattctcga acatttcaaa
86821 gataacgctt gacagtctag ccaactagcg tagaatgcct agccaagggg tgcataagcg
86881 ccccattcaa aaggatacat agaatggcca tcgttgatcg aaccgcaggt aatgaaagcc
86941 cgaatcactg ctacatcgtc actggcagca tcggcccgga gttcgagcca ttgcttttca
87001 caaccaaaaa gctggcactg caatatgcaa agcaagtcgc cggatatggt aaggcaaacg
87061 acgttttccc gccctttacg ccggttatcg agacccggca caaggaggat atgcatcggt
87121 tcaccattca caacaaaatc ccggaatagg agataaatcg ttgaaactct ctcaaattct
87181 ccaagcaggc ctcgactacg ctatcttcag aggaagtacg tggtatatgt gtgtgcgtct
87241 ccgggagcta gacttgccag ttgatctcgg cggcgtgcta atggacattc aatccatcat
87301 ggacgaagcc ggaatgatcc gggactctag ctgggatggc ggcgtggacg actacttttg
87361 ggaaaccggc atggctgatg cctatgtgat gacggtacaa gaggccgttg attacgggag
87421 tccagcttat gccatgtggg tgcaattttg gttcttcgta atctttgact tagcccgaaa
87481 agggcagtag aatagccagc aaataatgtg atctagagga acgatcatgg gcgacaagac
87541 tgtagtttat cgggtggagt gcatgaacgg cgaagggccg tatgtcaact atggtatgga
87601 gattgatacg tcttctactc ctgagcggcc tgtaccggag catgacggga tacctgatgt
87661 acgccatttt gagtatttcg cctttacgtc ccctagccag ctagatgact ggttcggcga
87721 ctactatggt caactgaccc agtactccag cgcctcaatc aagatgtatg aggtggacag
87781 gcagcacgta aggactggtc tccggcagtg tgtattccgc agggatgcgg cggtttgcgt
87841 caaggaagta accattgccc aatgggtggg cctactcaag gctggcatga tcgctgcggt
87901 tgtcacacaa gctctggccc cgattccagc cgaacaacta tccctagacc tagggcttgc
87961 cggcctgtga ggctcagaaa gaaattctcg aaatattcgg tttgtagggt tgacagctta
88021 ggccattcgt gtagaatggc cctcaagcaa gacaaaccgc cggcaggcaa aaccacaaac
88081 ccggagactc accatgaaca agccaatgaa tactttcgca tacgcccact acgtcgcccg
88141 catggacaag gcctctggca ctagcctgcc ctacgccacc ctgttccgca tcgccctgcg
88201 taacgcctac cgcaagccgg gtgtccgcca gtacgattgt gcagcactcg tcgaggatat
88261 caaagcgcgt gaactggtcc aaaagcgcat tcgggctgaa aaagcagtag tgatggcggc
88321 agtaatgcgt gcaatccgta ccggcttcac cgttagcgtg aaggatggca gcgatggcga
88381 gtgggtagtg aagaagtcta ccgatatcaa ggaaatctct gatagcctgc aatctaccga
88441 cgaggatatc atccgcttcc gcaagggcga cggcccggac aacatcgtcg gctctatgtg
88501 ggcaatctac ggtaacagcg ccggcgaagt gatcgccgac tggactgata atgccaccat
88561 ggccatgatt atggctcccg cagaacgcaa gatggaaaaa tacgctgaat taggtatcta
88621 atgcttgacg gggcccgaaa agggccccat aatgcaccca taccagcaaa caacatcagg
88681 accgccccga tgagccagat taaaatccaa gagtatatcg tagccgagat caaggttaac
88741 cattgcgctc acctgcgcaa gggccagacc atccaagccc gcgatgctcg tagcagtgaa
88801 aagtggattg cattcatggt ggaacgcggg tatagtgcct ctgaagccgc tatcctgttc
88861 aaagatgcac atgatgtggc aattctcgaa ctggcagcct gaagaaaatc ctactaggag
88921 tgctgacaaa tgaaacgcca atatactgat tcctaccagt gcaaagcaat cgacggcctg
88981 atgtctatct gcggtggtaa gaaagctatc gtacaagtgt ggccgtcctt gaaagcctct
89041 cgaaaccgcc ggctgaaaaa gatggtaaaa tacattgccc ggtcaggatg gaaaccgtaa
89101 ccaactgatt atcacagccc cggcttgccg gggctcacaa taggagataa aagcatgaat
89161 accctgatta tccgtttgga ttccgcctac agcgttcaaa ctgtccgtag ttttcttatg
89221 gaagctgtag agagtattcg aaagcatatc cgggactacg cggttcatga cgaatacgat
89281 tcgggattga gcccggtagc acccaatcat cgacttgcaa tcgtcacctt agacgaagat
89341 tgccgagtgt ttcacattca atgcgagtca cctgatcttt atctggcgaa ccctcggatc
89401 gtgtttactg atgttgaaag cccggcatat accactcccg tgaacgagat cgaagagtat
89461 agttacatga ccgcatggca gcatatccgc caaaaagata tgacagcaaa agactacctg
89521 tcggattggt ctatcctttt cgcctcaaag gagaatgcca ttgatatcga cccgcgcccc
89581 aatctgaaaa cgcaaatctt gcattaactg agggagctag gatgaagctt cgaaccatat
89641 tcgaaaccta cgattgccga gttaggtttg tcaccataac cggcgtgttt gtggaatctc
89701 aaattgtgcg gagtttcggt caagctcagg agattgtatc actcctctgc aatcccgcag
89761 atactggtat ccgtctatcc ttcttcgacg aagaggaggg ctgcgagtcg atcctctgcc
89821 gattcaacta caaaggagaa atcatcaaat gaataacaag tataaggata acatcattgc
89881 ggaatactgc catttcgacg gcagacggcc agtcctttcc ttggcggcac gatgggtcca
89941 ccacgacagt cgagttgtga agctggcagc gctctttgcc tgtgctggct atggccgtcc
90001 gtacaaagat tgtattaagg cctacaagga cgccaagcag cgggaaaagg atatgcgaaa
90061 ccctgccaaa tggaagctga gccgagcgac taagcgggct ctacgggctc gactagtggc
90121 tatagaaaaa ctagaataat ccggaaaata cctgttgacg tgaggctaga gggttcccta
90181 tactgtgcct atcgagacgc acaaggcgtc tcctaagcta gaaggactag caaaatggca
90241 aaggcaaatc tgaagttctc ccgcattggc aatgacggct acgactacgc ccgcagggaa
90301 gacggggttt ggtttgtcag agaagggtac tacgggcggt acggctgggc taaaaccaaa
90361 tggactcaag ttcaacccgg agatggcatg actatagtta acgcctgcct gaaggctcac
90421 gaagctggaa gctccagcac atacatcgga ttcgggaatc tggtggtatt ctccgacggg
90481 aaggggctcc gtttaccctg aacaggaact caaataaagt tgttgacagc ttaggccatt
90541 cctgtagaat ggccatcaag caaagggaat cgccctgagc aactgaatag gtaaaagacg
90601 atgcaagcaa cctaccaagc cctgaaaact ctgcgcgatg cttgtgaagc tgtcaaggat
90661 gaaaaaggca ccatcaacgg aaacaaattg aatgcactgc gtaacaaggc tgtcaaggaa
90721 atgcaagctg gtggtgaaac ctactctgac gccattagca tggctcacga cttgattaag
90781 aagtatcgca agtaaccgta accccggttc gccgggtcat cacagagcac gaccgaggag
90841 acaacatgaa taactcgcct gtagttgtat gtcttaagtg tggagcagtc aacggcggtc
90901 agagcaaaca caattgggtt atcgcattgg gtaagaagtg gtgcggtcat tgtgggtcca
90961 atctcgcaac ccttcgtcgc taaccgttca ctgaagccta atcgaggaga caacatgaac
91021 gccactctgg cacgtctaca gaacgaacgc tgtgcaaccc tccgcctgat gcttctgccg
91081 gaacatcgtg ggtatcagtt ctctggccat ccttgggccg agcgcatccg caatctccac
91141 gatgaagcta agtgcatccg cagccatcac taaaccgcac taatccatta aagctctaac
91201 agcccgcctt gtgcgggctt tgttctatct gcgaaagcgg agctttcaag tgtaattaac
91261 atgtaatgtt gtaacactct gtagaaggta gcactagcat gacaagatag accacttgta
91321 acgttaacgt tacatgtata acagcatgac agcgaaagct gtacagatag cattctgtcc
91381 agttcacccc tatcaaataa ccccacaata acccacctaa aacctatcgg ttttaagcgg
91441 cctgtaaggc cgtatatgaa gcgatagctt cgctatgtta gtctgcaccg tcaaggcgaa
91501 agccttatgg tataaggctt gtaggaggtt ttagggccat atgcgattag cataggatgt
91561 tggttgtttt aggtagattt tgggtataac ccctttccgc gctaccactt tgacgtttgt
91621 gttaagcgac agcttacatc cgctctcatt ttgcaatgag aattgcgtac agttcatcat
91681 gcgcctcaga agtgacttca ctttgcatgc ggatgcatgc tatagtatac cctgtgatag
91741 ctccgctatc ccgttttgca tggcacacga attgcataag catgacaagg gtaaccctcg
91801 aaagcggagc tttcaaagtg taggctctac ctctattata tttgcgaccg gaagtagtga
91861 cactgaaaac attgactcca gcccagcaaa tacgttaaac tacaaggtgg atagctgccg
91921 ctatcaatag atcaaaattc acacaaggag acccaatgac aagcaacatt catgccaaga
91981 tgcacattca ttacgctaag caaatctatt acgctatgcg taaacgtgcc atcgcaagcg
92041 atgagatatg caaggaatgg gccaagccca agacgggctt tgaagcgttc tatgattggg
92101 tggtgaatgt gtcagggtac gccgtaggct accgcctaga caggaatatt ctcttcccgg
92161 gaaacaagct ctatgctccg catacatgcg agttctcgcc tacatacatt cataccctct
92221 tcaccaactg cgacaagaca agcaataacc gtgccaacaa tgatctacct ctaggcgtcc
92281 gcctagcaag gtttgaccga tggagactgc ctgtatacgt ctcacagtgt agaacgctag
92341 ggaagcaaac cacactagga tcgttcgacg atccaatggc agcgcatgtg gcatggcaac
92401 atgccaagat ggaatccatc ctcgaatgta tcgatctcta tcagatggaa gacgttcaca
92461 gtgtagacgt tgttcaagct ctgcttgata gagtggacaa acttgacaag gatattgcac
92521 aaggtaggga aaccattttg ttgcagtagt ctcccatggc ccaacggcta cccgtctaga
92581 gtgcgagtaa tccgatagcg aagctatcaa tcgtatatgc atattccatg ccaacatgcg
92641 gaaagatttt accgggcagg gcgggagccc gttggcatta gttttgcata gcttagctgt
92701 cgctaagaag gaaagaccac ggccacccat tattttggga ttacgtgagg ttaggtatgc
92761 ctagtgggtt cgtggtt
//