List of phages of the species vB_PaeP_p2-10_Or1_genome currently in database:

			

LOCUS NC_019813 44030 bp DNA linear PHG
DEFINITION Pseudomonas phage vB_PaeP_p2-10_Or1, complete genome.
ACCESSION NC_019813
VERSION NC_019813.1 GI:429315958
DBLINK Project: 183543 BioProject: PRJNA183543
KEYWORDS RefSeq; complete genome.
SOURCE Pseudomonas phage vB_PaeP_p2-10_Or1
ORGANISM Pseudomonas phage vB_PaeP_p2-10_Or1 Viruses; dsDNA viruses, no RNA
stage; Caudovirales; Podoviridae.
REFERENCE 1
AUTHORS Blouin,Y., Kutter,E., Pleteneva,E., Loukou,G., Vergnaud,G.,
Cablanmian,A., Essoh,C., Vu Thien,H., Pourcel,C., Lathro,S. and
Krylov,V.
TITLE The susceptibility of Pseudomonas aeruginosa isolates from cystic
fibrosis patients to bacteriophages and the role of CRISPR-Cas
systems
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 44030)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (10-DEC-2012) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 44030)
AUTHORS Vergnaud,G.
TITLE Direct Submission
JOURNAL Submitted (22-SEP-2012) DGA/MRIS, Mission Recherche et, Innovation
Scientifique, 7-9 rue des Mathurins, 92220 Bagneux, FRANCE
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. The reference sequence is identical to HF543949.
COMPLETENESS: full length.
FEATURES Location/Qualifiers
source 1..44030
/organism="Pseudomonas phage vB_PaeP_p2-10_Or1"
/mol_type="genomic DNA"
/isolation_source="sewer water sample"
/host="Pseudomonas aeruginosa"
/db_xref="taxon:1234701"
/country="France:Orsay"
tRNA 553..625
/product="tRNA-Asn"
/note="codon recognized: GTT"
/anticodon=(pos:586..588,aa:Asn,seq:gtt)
/codon_recognized="AAC"
tRNA 633..705
/product="tRNA-Asp"
/note="codon recognized: GTC"
/anticodon=(pos:666..668,aa:Asp,seq:gtc)
/codon_recognized="GAC"
tRNA 713..787
/product="tRNA-Pro"
/note="codon recognized: TGG"
/anticodon=(pos:748..750,aa:Pro,seq:tgg)
/codon_recognized="CCA"
gene 812..1270
/locus_tag="BN425_orf_01"
/db_xref="GeneID:14217098"
CDS 812..1270
/locus_tag="BN425_orf_01"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p01"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183209.1"
/db_xref="GI:429315959 GeneID:14217098"
/translation="MSDEKVVSIGAAPLSAKEKLDLYCEGLADGLNKTQAYVAAGFSPN
HAQRNVAAYHRKHAEYINAFISERIGSHVPMALRVIVSIAEDPNEKGGIRLKAAQDILD
RGGFGAKQKVELTTKNVEDMSAEDLMNEVRRILDEEPDLAKVLSFPTA"
gene 1203..1700
/locus_tag="BN425_orf_02"
/db_xref="GeneID:14217041"
CDS 1203..1700
/locus_tag="BN425_orf_02"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p02"
/codon_start=1
/transl_table=11
/product="lysozyme"
/protein_id="YP_007183210.1"
/db_xref="GI:429315960 GeneID:14217041"
/translation="MKFDEYSTKSQTWLKSFLSRPLDFLSLIKKREGLVLQWYKDSLGY
WTGGYGHLQRPGEDGPITLARAETWLENDSQAAYDAAQRQVSELPFCTPELFDALVSVN
FQLGTAWTKKFPKTWNLLKAGEFDRAAWEAEDSAWAKQTPVRVRDLQRALWRASTIGST
VT"
gene 1700..3148
/locus_tag="BN425_orf_03"
/db_xref="GeneID:14217042"
CDS 1700..3148
/locus_tag="BN425_orf_03"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p03"
/codon_start=1
/transl_table=11
/product="terminase"
/protein_id="YP_007183211.1"
/db_xref="GI:429315961 GeneID:14217042"
/translation="MDTQERLRNLVRELAERQKYFRMNQYTPYGWQEKFIAASSNCAQL
LAMTGNRCGKTYTGAFIMACHLTGRYPEWWTGRKFDKPVNCWAAGISTDTTRDILQSEL
LGDWKNPEAFGTGMIPKEDIVKTERREGKPGCVQAVMVRHVSGGLSSLIFKSYEMSQDK
FMGTAIDVIWLDEECPKDIYTQCVTRTATTGGIVYLTFTPEHGLTEIVKDFLQDLKPGQ
FLIHASWEDAPHLSPEVKEQLLSVYSPAERRMRAEGIPMLGSGVVFPILEEKFVCEPFD
IPDHFHRIIGIDLGFDHPNAIACVAWDAEKDKYYLYDERSESGETLGMHADAIYLKGGH
QIPVVVPHDAFKHDGATSGRRFVDLLKDDHNLNVVYEPFSNPPGPDGKHGGNSVEFGVN
WMLTRMENGDLKVFNTCTNFLKEMKMYHRKDGKIVDRNDDMISATRYALLMASRHARPG
AVRNSGYYRSDTARLIPDWFGSIV"
gene 3149..5266
/locus_tag="BN425_orf_04"
/db_xref="GeneID:14217043"
CDS 3149..5266
/locus_tag="BN425_orf_04"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p04"
/codon_start=1
/transl_table=11
/product="putative portal protein"
/protein_id="YP_007183212.1"
/db_xref="GI:429315962 GeneID:14217043"
/translation="MAKRRKIKPMDDEQVLRHLDQLVNDALDFNSSELSKQRSEALKYY
FGEPFGNERPGKSGIVSRDVQETVDWIMPSLMKVFTSGGQVVKYEPDTAEDVEQAEQET
EYVNYLFMRKNEGFKIMFDWFQDTLMMKTGVVKVYVDEVLKPTFERFSGLSEDMVADIL
SDPDTSILAQSVDDDGTYTIKIRKDKKKREIKVLCVKPENFLVDRLATCIDDARFLCHR
EKYTVSDLRLLGVPEDVLDELPYDEYEFSDSQPERLVRDNFDMTGQLQYNSGDDAEANR
EVWASECYTLLDVDGDGISELRRILYVGDYIISNEPWDCRPFADLNAYRIAHKFHGMSV
YDKIRDIQEIRSVLMRNIMDNIYRTNQGRSVVLDGQVNLEDLLTNEAAGIVRVKSMNSI
TPLETPQLSGEVYGMLDRLEADRGKRTGITDRTRGLDQNTLHSNQAAMSVNQLMTAAEQ
QIDLIARMFAETGVKRLFQLLHDHAIKYQNQEEVFQLRGKWVSVNPANWRERSDLTVTV
GIGNMNKDQQMLHLMRIWEMAQAVVGGGGLGVLVSEQNLYNILKEVTENAGYKDPDRFW
TNPNSPEALQAKAIREQKEAQPKPEDIKAQADAQRAQSDALAKQAEAQMKQVEAQIRLA
EIELKKQEAVLQQREMALKEAELQLERDRFTWERARNEAEYHLEATQARAAYIGDGKVP
ETKKPAKAVRK"
gene 5511..6515
/locus_tag="BN425_orf_05"
/db_xref="GeneID:14217044"
CDS 5511..6515
/locus_tag="BN425_orf_05"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p06"
/codon_start=1
/transl_table=11
/product="putative scaffold protein"
/protein_id="YP_007183213.1"
/db_xref="GI:429315963 GeneID:14217044"
/translation="MDLENQGMDEFEAAEAFGDLLGDDLLAPGDETVDGKVIGEEEEEE
VEKETPEGESEDEPEEEPEEDPEGESEEEPEEGSEDDLSDKLFEIPIGDDIYEVNLEEL
KSGYLRNEEFVTRQAELEEEYAAKLESVDAERANLLAELEQYTVTAIAGANQYDSINWE
QLKAQDPEKYQKLRLEALEAREQAQALIKRRNDIKAMQEKRAEIIHSSYIKRQTELAKK
LIPEMTTDETWGDKIVAYGKSIGYSEDEIRGIADARQLAVLDAARKWAESQVRRKAALE
KKEETELPAAVKPVARRAEASEGSKRVKAARANLRKDQSVEAAAALFSSLDIF"
gene 6534..7487
/locus_tag="BN425_orf_06"
/db_xref="GeneID:14217045"
CDS 6534..7487
/locus_tag="BN425_orf_06"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p07"
/codon_start=1
/transl_table=11
/product="major head protein"
/protein_id="YP_007183214.1"
/db_xref="GI:429315964 GeneID:14217045"
/translation="MATPTNAVSTVEINGKREDLIDIIYNIAPYDTPFMSAIGKGVATA
ITHEWQTDELRQPGKNTRVEGEDATIKAGSFTTMLNNYCQISDETLQVTGTADKVKKAG
RKNELAYQLAKKSKELKLDMEYALVGAPQAKIQRNTTTPGQMANIFAYYKTNGSLGAKG
VAPIGDGSDTGTAGDLRLLTEDMLLNTSESIWRNGGQANSIQTSSSIKKAISKNMKGRA
TEITLDASDNRIAQTVDVYESDFGKYTIRANRWFHENTLFVFDPKMHSLCYLRPFFQHE
LAKTGDSEKRQLLVEYTFRVNNEKSGALIRDVVAQL"
gene 7535..7855
/locus_tag="BN425_orf_07"
/db_xref="GeneID:14217046"
CDS 7535..7855
/locus_tag="BN425_orf_07"
/inference="similar to DNA
sequence:RefSeq:NC_010325:PPLUZ24_gp61"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183215.1"
/db_xref="GI:429315965 GeneID:14217046"
/translation="MSIQSTYAIDEDLGLFIRKDTQDVESILSANAEERHSGVNTNRKD
NLRKVASIPLVVVEALRNRPMSEGGPIDLNLIGCDPDHAARFTRWLNDRDNYRMRTSEA
RV"
gene 7858..8484
/locus_tag="BN425_orf_08"
/db_xref="GeneID:14217047"
CDS 7858..8484
/locus_tag="BN425_orf_08"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p09"
/codon_start=1
/transl_table=11
/product="constituent protein"
/protein_id="YP_007183216.1"
/db_xref="GI:429315966 GeneID:14217047"
/translation="MATINNVTDLAIAAIQWSDRQDLTQELLMLFIGNTTDRLNRLLRV
RENEHFETLMAFGGGIEIPEHFVALRSITGDALIGGRTLQYITQDVFSHYVNYNYQPQG
VTYYTRLGNFWRVYPVVPDGAPFIVNYWTVLPELSLANPTTWALTKYPQIYLYGVLEQI
YLYTMDEERSMFWGQKMERAVMELQNEENAADFASTRLAIKDIER"
gene 8327..8686
/locus_tag="BN425_orf_09"
/db_xref="GeneID:14217048"
CDS 8327..8686
/locus_tag="BN425_orf_09"
/inference="similar to DNA
sequence:RefSeq:NC_010325:PPLUZ24_gp59"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183217.1"
/db_xref="GI:429315967 GeneID:14217048"
/translation="MVSLSRFICTPWMKSGRCSGDRKWNGQSWNSRMKRMPLTSLALDW
RSRISNVKEHPMPIFLKTLAINLLATLFPTKVIAKSIVTGAKALAEKTNSKVDDEFVKV
LEDNLKEKSEDAITN"
gene 8670..8918
/locus_tag="BN425_orf_10"
/db_xref="GeneID:14217049"
CDS 8670..8918
/locus_tag="BN425_orf_10"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p11"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183218.1"
/db_xref="GI:429315968 GeneID:14217049"
/translation="MQLLTDNLGSIVSALVVSSVVTVGSSVVGQSVHQALLERNIQATE
KLTQAVSELQISMAIFGERYVTRKEMKEELKEAKNGS"
gene 8908..9555
/locus_tag="BN425_orf_11"
/db_xref="GeneID:14217050"
CDS 8908..9555
/locus_tag="BN425_orf_11"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p12"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183219.1"
/db_xref="GI:429315969 GeneID:14217050"
/translation="MGLEVATYIDQLVPTNPTGSDLKSFGDDHIRLIKSAIKNTFPNIN
QAVTVTASQLNAVADTTQYVKPGMVIMWAGTLAQIPAGWKLCNGVGTTSNGIPVPNLIG
AFPWGIDGTSEAVGTRGGNANIIWDGLTEGHALTLAQIPAHTHTWRTRGATTLTGSAGD
SGALTGGSGNAANTNLETGPAGQGQAHTHTVKINMPLGNIPPFCAVFFIIKN"
gene 9552..11105
/locus_tag="BN425_orf_12"
/db_xref="GeneID:14217051"
CDS 9552..11105
/locus_tag="BN425_orf_12"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p13"
/codon_start=1
/transl_table=11
/product="constituent protein"
/protein_id="YP_007183220.1"
/db_xref="GI:429315970 GeneID:14217051"
/translation="MRYKMALERQEVKNPTGIVTDIAPADLPLDKWSFGNNVRFKNGKA
HKALGHSPIFDTAQAPILDMFPFIRNNIPYWLLCSEKRLYLADGTTIIDVSPGQYSASV
TNRWSVGSFNGVIFANDGVNPPHHLPPTESVFRVLPNFPANTTFRRLKSFKNFLVGLNV
TSNSIEMPQMVWWSTSADAGGVPASWDPTDPTKDAGQNTLADTNGAIVDGVKLRDSFII
YKEDSVYSMRYIGGLYIFQFQQLFNDVGILGPNCAIEFDGNHFVVGHGDVYVHNGVQKQ
SVIDAQVRKFFFSDINPDNYQRTFVLADHVNTEMWVCYSSTRSEPGKHCDRAIIWNWKE
NTWSIRDLPNVLSGAYGIIDPKTSNLWDDDSNHWDTDTSVWGEGSYNPAKSSMIFTSFQ
DAKLFLFGETSTFSGQSFTSTLERSDIYLGDDRMMKTVSAVIPHITGNGVCNIWVGSAQ
VQGSGIRWKGPYPYRIGQDYKIDTKHVGRYIALKFDFASAGDWYFNGYTLEMAPKAGMR"
gene 11051..11791
/locus_tag="BN425_orf_13"
/db_xref="GeneID:14217052"
CDS 11051..11791
/locus_tag="BN425_orf_13"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p14"
/codon_start=1
/transl_table=11
/product="constituent protein"
/protein_id="YP_007183221.1"
/db_xref="GI:429315971 GeneID:14217052"
/translation="MVLQWIYFGNGPEGRYAMSQRYSPSIPPQEEEELLPFLNEEFVRV
GQTLNDVADGYWGVSMEPPKKLKPGTVKYFAPGVVGPVSGIYYYDLDNQWKLAGTKPKD
LPGDFILFTPANNHQAMGTCAYRMNTDKDEVWITLLASGGNYTDGATVLDLPQAYWPPA
ELFIPAFSSIIPAQSQITYPPPSDPNAPPLDQVFDVLNRATIQTAVVNQAMFKLTANGR
LLIQGIPQGAIFGGTFTYPLVVTP"
gene 11788..12222
/locus_tag="BN425_orf_14"
/db_xref="GeneID:14217053"
CDS 11788..12222
/locus_tag="BN425_orf_14"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p15"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183222.1"
/db_xref="GI:429315972 GeneID:14217053"
/translation="MIHLITRENIESLPTVAPALARAFNRTDLGKFWDFEHLVHSLVNY
EAFVFYQEESGYAGVLQVSQAPLGNILHFFWSGKMPGNETPIDYPEVDEYLGQFAQKMG
CRFIQCEGRRGWKPTLEKLGYTEDSVTFYREVTPDELPPI"
gene 12203..13147
/locus_tag="BN425_orf_15"
/db_xref="GeneID:14217054"
CDS 12203..13147
/locus_tag="BN425_orf_15"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p16"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183223.1"
/db_xref="GI:429315973 GeneID:14217054"
/translation="MNFLQFNVKRLMGFNVEDALDSRAYKGGSKKQTTTSTSTPYQQGN
YNELLSGASSWLHNGGFDPNYGGDPNFDPVADQNALQLGGIEGLGNLGGALQSLLGSSG
VSSLADYLGPYDPNKTGLANAIGAANEQMQWDFDTTVRPDLRAGATNAGQYGRSRAGVA
EGIATARLLQNQQNNASQLAFQDQQSYNQNRLNTLGNLSAIAKGLGSGNAMQVDAGSML
QGQEQQEINGALQKWAYENNVSLNDLLAYKELISGDMGGTNVSVTKGSGGGGGGLGSAL
GALGGASLGALFGGPAGASVGMNAGGRVGGLLF"
gene 13147..13530
/locus_tag="BN425_orf_16"
/db_xref="GeneID:14217055"
CDS 13147..13530
/locus_tag="BN425_orf_16"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p17"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183224.1"
/db_xref="GI:429315974 GeneID:14217055"
/translation="MASLTQKLFTIGQNIGGGQERVQLSRQGSYRPVHLGSGLSEESSS
GQSNPFGAMGGAALAALLGKGSDSTPETVPSFSVEGARGASEQGAANVAAGMGAGMGIL
PSAEDLGFGQLPKSGILSKLFGG"
gene 13520..15058
/locus_tag="BN425_orf_17"
/db_xref="GeneID:14217056"
CDS 13520..15058
/locus_tag="BN425_orf_17"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p18"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183225.1"
/db_xref="GI:429315975 GeneID:14217056"
/translation="MEVNPMASMAYEGSPIRPSILRAAQNELDMARIARNKLPLAVEGS
GIPDRVRRAAQAALENPERWSRAAQEVAPAAEATGRGALGRIAGILGGPVGVGVQAAVT
PADIGDQERTRAEEMAQAAQAVENMGPEVAQSANQWAQGVGQRAAQNATGGPQGAGLLS
YGVTPNQPSIEPEITPEVASEAGAAVADEGEANRQVIQQGAAEGLRTGAVSRPEMAQAV
VEADAQREGVELKPQELKNRVNEELTQMRTMNNDDLSRYVSYALIGTGLLASALDKTGK
AGDMFAASYERQLDRNLQAGINQQKMAAAAADRQIKEKDLERKVAKDKSDERLGIGNLE
VKRGTLEETSRKNEGLLSKWGKQAAVERAKLALTQRGQDLATQRAQLQAETARRGQDMS
QENAQLNSAVRLKTAKISAAARKAAASASRGEAITTKDANELVKGVSGSDLVGGAKIGE
QDQSAISQKLRNHLRQNPGADPVTFVQQEAAKLQKQPSGLFGWGSGILSRPAPK"
gene 15214..18384
/locus_tag="BN425_orf_18"
/db_xref="GeneID:14217057"
CDS 15214..18384
/locus_tag="BN425_orf_18"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p19"
/codon_start=1
/transl_table=11
/product="constituent protein"
/protein_id="YP_007183226.1"
/db_xref="GI:429315976 GeneID:14217057"
/translation="MALSPEMKAAIAAELAEVKDLDVAAELASLNEPEEVEVAPQEVTP
EVVPEAAPDLSALAAPADPNSIGSAINRGIDTMQSNIGGTIATVGELTGSDYLKDYGTQ
MAEENAQEASQYGTPDVRSFADIQDIPSIGSFLKNNISEALPSMGAVMAGGAAGAKVGS
MFGAPGRMGGALIGSFLSSMGINVGALNNQMKELDPEGSNPWTAVLGGAGLSVLDTAGA
GVIAAPLLKHIGKDGAYQMLVQSGLPKQTAIEAVTQAGKHAAVSGVAEGVTSGAQQALQ
DTIAYDAVGQVQRPEEFMDNLLTAAFAGSAMGVGGGAVSSGLNTMASNKDSAGSAHTDP
NAPSAGPTASEMEPRGTIRKAWDAMGNEATALLEPLAKASPIAREFSETFRADMSGERA
SGKTIFEDQELQAGKWNTTLDNIIEGKSNKEIRQIINDASMGVNTPEATALRDILNDVR
AEASGRGGMSVGNIVNYMPFGLSRKKVESPEFLDDITPYFQDRQAAEDAVANWLAETSD
DTRGNTAPEVTRLVTQNQTTGAWEVDPRYRIQGDPDTLRGRFAQSDAVPKYGQLEESRS
FGSVPQEILNKYTLNESPKDLIQEIRDYFEGSSHRIAFTERFGINGEKANAMIASAVAE
AQQNGKRVTKEEVDRMYDLVDAYNGMHGRIKDPNIKKLAAVVSGGLVLSRLPLAGLSTL
TEFSIPFAKAGPMTALGAVLPTVGEVARQATRSVFSSIPKSETGRLMSDMNHTLASATS
LMADRVGAEVFNQYTQKAVRGMFLVNGLSILTHVDRVFATETAKRVYQNNLMDLAAGLP
FSSANGALKVAQLREMGVNVSSQADALRLVSPATPSEVLMANNVKTLAIRRFVDQTVLD
PTFADKPMWMSNGNVQMFGLLKGYPAAYGNIILPMMRRRLSPHFTGSWTNAGMGAAGVA
FTLGLMMSLGYIQDELRQMAKFGGSSREDTRSEEQRIMDVLMQQMPLQASMIYDMLTAY
RRGTTPAEVLLGPVAGAATEGALAAGKTIASFNDDPSAGEIWKFLYKQTPARPFVAGME
AMEDALDL"
gene 18218..19282
/locus_tag="BN425_orf_19"
/db_xref="GeneID:14217058"
CDS 18218..19282
/locus_tag="BN425_orf_19"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p20"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183227.1"
/db_xref="GI:429315977 GeneID:14217058"
/translation="MSQVQLPKELWLLVRLLHPSMMILPLVRFGSSCISKLRPVLSLQV
WKQWKTLWIYKEKYMATYVETEAAGPGGRAYVVDVPQVFRRNKDGDLIEITADAGRVNT
NIVTATEFLPDYYAVKENAALVVENVTASYPDHPSEAVVPSVLVNTLIGAPGETSGGNV
DPGHVIGLFSETMVEAPCGTAFGSEFRVDPRREHLGVYVAIKHVIGPDDQNGGTIGDYI
IEQFDDMRGPVQNIGSLQQNYLDPRLVTTHLGGNVVNTAQLNGNITLTRQNSGQHFMSM
SATDITVTLGPDVTPGCVFHFVQGAAGKIKFAVSPDKAWYAKGNQTKTDAQFGECTVRV
YPFGGTVGSFKSGL"
gene 19325..19681
/locus_tag="BN425_orf_20"
/db_xref="GeneID:14217059"
CDS 19325..19681
/locus_tag="BN425_orf_20"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p21"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183228.1"
/db_xref="GI:429315978 GeneID:14217059"
/translation="MATYIEDANGESVFVIQSKAIAVRNEDGTLRHVIGPKDLKPVQWD
EVEGKPELLEVGSKANEAKPGNWKPKASEVVGLDAVVKAAIEDRIKDIPVASYQDSHEA
LVDKFNTLLNALRG"
gene complement(19730..20032)
/locus_tag="BN425_orf_21"
/db_xref="GeneID:14217060"
CDS complement(19730..20032)
/locus_tag="BN425_orf_21"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p22"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183229.1"
/db_xref="GI:429315979 GeneID:14217060"
/translation="MTDVTPDDGRTLKSILRDIVMGGKFMKYRVKQVGKYFFPQYKKAF
LWRNFESEHKDPFRPSLSDITLPVIFETLQDAMCFIRDFADTKNESVVKYHPVEV"
gene complement(20102..20353)
/locus_tag="BN425_orf_22"
/db_xref="GeneID:14217061"
CDS complement(20102..20353)
/locus_tag="BN425_orf_22"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p23"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183230.1"
/db_xref="GI:429315980 GeneID:14217061"
/translation="MTLSMYSGLATRWCTMTKAELEDLLTEMEGQLAKSEAKLATFKKA
ALEAKERLEMLEAMLDLVDQRSSVFYGDWRGYEERSKG"
gene complement(20295..20504)
/locus_tag="BN425_orf_23"
/db_xref="GeneID:14217062"
CDS complement(20295..20504)
/locus_tag="BN425_orf_23"
/inference="similar to DNA
sequence:RefSeq:NC_010325:PPLUZ24_gp46"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183231.1"
/db_xref="GI:429315981 GeneID:14217062"
/translation="MRDRVGRELEVGDKVVFLVHRNTSSHLAIGVVDGFTPKMIRIKCP
TMSWTIDSEYVLRTSDKVVYYDES"
gene complement(20507..20662)
/locus_tag="BN425_orf_24"
/db_xref="GeneID:14217063"
CDS complement(20507..20662)
/locus_tag="BN425_orf_24"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p24"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183232.1"
/db_xref="GI:429315982 GeneID:14217063"
/translation="MAFKTPLSAELWLDMKFGRGGAAEGKARGMYSIEVLEILYIPSIH
LPDIKG"
gene complement(20722..21483)
/locus_tag="BN425_orf_25"
/db_xref="GeneID:14217064"
CDS complement(20722..21483)
/locus_tag="BN425_orf_25"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p25"
/codon_start=1
/transl_table=11
/product="constituent protein"
/protein_id="YP_007183233.1"
/db_xref="GI:429315983 GeneID:14217064"
/translation="MSKRYNEDTLVIADTQVRPGVNVDHLGNLGEWIARNRPKRIVHIG
DHWDMPSLSSYDRGTAKIEGRRVLSDIQAGNDAMRLLLNPLRRLQSHQASCKKRVYRPE
MHFFIGNHEERIKRYENSNPALQGFIGYDHFDLSDWIVHDFLDVGVIEGVAFSHYFYNP
NSGRPYGGSAEHRLNKIKRSFVQGHEQGFKYHIEAVGKERIHGLVVGSFYTHDESYKGP
QGNDHWRGVALLRNHKGGEYDLKLMSVGEFL"
gene complement(21476..21916)
/locus_tag="BN425_orf_26"
/db_xref="GeneID:14217065"
CDS complement(21476..21916)
/locus_tag="BN425_orf_26"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p26"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183234.1"
/db_xref="GI:429315984 GeneID:14217065"
/translation="MSVQGRFFRPKLKSLIGTPYDSNTEKIVHETMPSMEFKPQPLTYV
VKHKYYPDFRASLETGSSTKILLVEVKGYFQEASEAAKYVWVRESLPPDTELVFIFEKP
DTACHWLKKRKDGTKQTMAEWAERNGFRWFTLETFKESFHNE"
gene complement(21678..22658)
/locus_tag="BN425_orf_27"
/db_xref="GeneID:14217066"
CDS complement(21678..22658)
/locus_tag="BN425_orf_27"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p27"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183235.1"
/db_xref="GI:429315985 GeneID:14217066"
/translation="MKMENYSIEEALRVCRELFKILEETTKFTGLRVGGGFLRDCDNGV
VPKDIDIYVVEPRTLQEVAIRNRVRVVPMAVDEDTIEVNVIRFFNAIGHKKVRLGDKEV
NNDYPNSFKVWESCEFPEGHLPVNLIVCNQEHPCVFDIGLCSISFWNGDHSLLYGPDYT
RDKGNKWLTLINIADPLLGHTVHENIISDGAVDRLVNHIRRVMEKYPDHKVKLSDNLLH
WVNLAGSNIQQSALKVIGRLQEENIIERPGEILPAQAEVIDWDALRLQHREDRSRDDAI
DGVQAATTHLRGEAQVLPRLQGIFRDWIIDEDFVGRGQGVLPRGV"
gene complement(22633..23574)
/locus_tag="BN425_orf_28"
/db_xref="GeneID:14217067"
CDS complement(22633..23574)
/locus_tag="BN425_orf_28"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p28"
/codon_start=1
/transl_table=11
/product="exonuclease"
/protein_id="YP_007183236.1"
/db_xref="GI:429315986 GeneID:14217067"
/translation="MPSPSTGKRFLRKVRRALRMIAGIDGDVLRYELGHIAMKKEHIFD
IEVVRPWPEEEVHELVDKKIEQIIERVGADDYEVYLTGKDNFRLELATIRQYKGTRVGN
TKPHHWQTVSDRLKGKWGAVTVNGIEADDWIGVRGTEEGDNFTACSRDKDIRQITECHH
YSWACGDKQPELGPFRNEGLGRVSASWRLYGKKKPQKSWKLEGYGTAFLYGQLLVGDSV
DNIPGCPEIGPKSAADLLGHLTTEKDLFQACAYEYQKVYGDNWKEYLTENFRLLYLIRD
RNWFDIEQSGNELNCRVIRHWEIPYEDGELFY"
gene complement(23501..23794)
/locus_tag="BN425_orf_29"
/db_xref="GeneID:14217068"
CDS complement(23501..23794)
/locus_tag="BN425_orf_29"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p29"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183237.1"
/db_xref="GI:429315987 GeneID:14217068"
/translation="MELLLDPRAKTVPSNYSVKGLEVDLGETPGYSLTEDAMDKARRQE
SEYYDWKGYEALANPVVEHPEYRSKGEAFALTKHWEEILKKGPEGSKDDRGD"
gene complement(23766..24401)
/locus_tag="BN425_orf_30"
/db_xref="GeneID:14217069"
CDS complement(23766..24401)
/locus_tag="BN425_orf_30"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p30"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183238.1"
/db_xref="GI:429315988 GeneID:14217069"
/translation="MPSVSVVYVSTRLYLVVMERMIRCSVVVSPRKRTSLRTYLVRTSM
TKMLLSKSLEDHEAGVCPLGCPYCLADYERIWGVRVVSSVAASNDKVEVDPNGIKAGDP
GAKLDKGKVDVGIIFEAFPRALYAVAQVANFGASKYSRGGWRFVENGIQRYDAAFGRHL
LERHKGEVLDPQSGLPHRYHEVWNALAALELVIQQEESSNGTSAGSEG"
gene complement(24247..24807)
/locus_tag="BN425_orf_31"
/db_xref="GeneID:14217070"
CDS complement(24247..24807)
/locus_tag="BN425_orf_31"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p31"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183239.1"
/db_xref="GI:429315989 GeneID:14217070"
/translation="MSKKVSQRFTFPVAKLIFPYIVTPDTEYGEVYQVTICIPTKEQAD
ELVAKMESKDARLKGTIKYTERDGEFLFKVKQKKHVDWMQDGERKSAVMKPIVLTSDNK
PYDGPNPWGGSTGEVGILIETQKGARGKGTITALRLRGVRLHEIVSGGDGEDDPLFGGG
FTEEEDKPEDVFGEDFDDEDAPI"
gene complement(24877..26496)
/locus_tag="BN425_orf_32"
/db_xref="GeneID:14217071"
CDS complement(24877..26496)
/locus_tag="BN425_orf_32"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p32"
/codon_start=1
/transl_table=11
/product="DNA polymerase1"
/protein_id="YP_007183240.1"
/db_xref="GI:429315990 GeneID:14217071"
/translation="MFVEHKVADIISRQSKRGVYFQTQRAKWLIHVLNERILKIDLEAV
PQMPPMIVQAGAFSKPFLKSGLPNKRLVALWQRLGHFEVSGPFTAIEYKDFDLGKTARF
KDWMLSQGWVPDQWNIKDITVGTDGKKLRGSDLNGALNRYIEDLRNSPSGPLRMKLQGI
IPGKTTIGEVKRKLEKQRKVLTTPKMTETSMDTIQGDLGKLVMQRMVWAHRRSLLQGLV
EQVKPNGRLEGSANPCATPTCRMRHRVVVNIPAARSPLGPEIRGLFQGTPNAGEWKWTV
LRRDIGENERVRPHTNIVEVLKGGKWKTVGKYRVYVPANQLIFVGYDGAGLELRMLASY
IGDPDYTREVVDGDVHTANQIAAGLPTRDDAKTFIYAFIYGAGDAKIGQIIGGTRADGA
RLREQFLKANPELAKLIERVKQEAERGYLVGLDGRKLTMRRSESGEVMVHKALNTLLQA
AGAIVMKWAMVILDEKVRRAGLKAWKVLDIHDEGQWECHPEDLATLRGFMETCVKEAGE
ILGCNCPLASDSIAGRSWYDTH"
gene complement(26515..26787)
/locus_tag="BN425_orf_33"
/db_xref="GeneID:14217072"
CDS complement(26515..26787)
/locus_tag="BN425_orf_33"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p33"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183241.1"
/db_xref="GI:429315991 GeneID:14217072"
/translation="MTWPTSLWTLLFAGAYPPSSMIGDDMSKVKSVLMERIDDYLLKQV
AVAFLEQQWRLDRSGTVDYLSYLEGISEDAVEVVVENLAERFKGV"
gene complement(26717..27406)
/locus_tag="BN425_orf_34"
/db_xref="GeneID:14217073"
CDS complement(26717..27406)
/locus_tag="BN425_orf_34"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p34"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183242.1"
/db_xref="GI:429315992 GeneID:14217073"
/translation="MVYHPRSVCLHQGSRVEPFGYRMDHLRERLGWCPGDYLRPLLLSL
VRQGFPQKGLTKVTFCGIITLWCRGLLLYLKERHMESHYACNLLVNDALSQAKAEEIRK
KLIQTYLMNPKVPLQAARSIFFKLPKNYLGYTYLSGHGKVERYSAKKQQRVVLKYLSLY
DDFYIDRHETFDPRNLLRDSLFNLHYYLKNNGSEERIRKEQRRVDLANFLVDLAICRGV
STFVHDW"
gene complement(27516..27680)
/locus_tag="BN425_orf_35"
/db_xref="GeneID:14217074"
CDS complement(27516..27680)
/locus_tag="BN425_orf_35"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p36"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183243.1"
/db_xref="GI:429315993 GeneID:14217074"
/translation="MDNKYKPTPQDEARKEAALEAAFSGGWGGPEVDADDFELGNACGL
DPEVCESCQ"
gene complement(27670..27861)
/locus_tag="BN425_orf_36"
/db_xref="GeneID:14217075"
CDS complement(27670..27861)
/locus_tag="BN425_orf_36"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p37"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183244.1"
/db_xref="GI:429315994 GeneID:14217075"
/translation="MKKYVVNVQFQDTKVFYADFYRIEGEIIRFFQGEADSNPLLNRSL
EVGAVRGWTSVEEKEDGQ"
gene complement(27893..28123)
/locus_tag="BN425_orf_37"
/db_xref="GeneID:14217076"
CDS complement(27893..28123)
/locus_tag="BN425_orf_37"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p38"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183245.1"
/db_xref="GI:429315995 GeneID:14217076"
/translation="MALSQEMLSGTEPAVRWKSVLDGNSGLTRWSITSNVLKMVAVTGI
LTSVSVATLLMLLMVVVLGIVRPKAFERKSK"
gene complement(28175..28702)
/locus_tag="BN425_orf_38"
/db_xref="GeneID:14217077"
CDS complement(28175..28702)
/locus_tag="BN425_orf_38"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p39"
/codon_start=1
/transl_table=11
/product="DNA polymerase2"
/protein_id="YP_007183246.1"
/db_xref="GI:429315996 GeneID:14217077"
/translation="MMKYPRTTSPQFDYVIYDLEGDALYDNVTRLWCAVLVDIPTQVVR
GFRPEEMETFYRIIAHAKFVVGHNILDYDNRVLEKLHGIVIPEERSYDTLVASRLTWPD
RPMGHSLGAWGRFLKCHKGDFNDFSKFSEEMFEYCLQDGVVSMALFNYLLKVLGMTWEE
LVEWRTGSWLNV"
gene complement(28665..30374)
/locus_tag="BN425_orf_39"
/db_xref="GeneID:14217078"
CDS complement(28665..30374)
/locus_tag="BN425_orf_39"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p40"
/codon_start=1
/transl_table=11
/product="primase/helicase"
/protein_id="YP_007183247.1"
/db_xref="GI:429315997 GeneID:14217078"
/translation="MKKIIGDTACPGCRAKGGDHTGNHLILFIDEEKGSRFGKCNRCGH
YEVLDEGFVVPKRTEKSEEDILREVAEVQEYPFKALDSRKISKTIAERYGVRVGLSMEN
GVDVIEHYYPRTKDGKYRAYNVRILDPKAFYYRGSPRGGVDPFGLETLFHKDVGHLKLI
ISEDELSAMSIAQIMESKLPEKWKHLRQASISWSSGVGSAGRDIGFLKESGILDRFQEV
VYCHDADEEGRKSVERVRALLPDCKFVEMPLKDANDMLMRNRADEVYQLIRFGSKVKSP
DCAVTVDEVFAEALEPPKWGKSYPWEGLTNLTMGQRDGEIVGVGGGTGIGKTLLAHHIA
AWNIIEHGENVGTFLLEEQVAMTLKNIAGKVAQRAFHRPDLEWDVEAFKDAAGQLRGKL
FMWKNKGQNDWDHIKECIRYWAVAMDVKTVILDNMTAMTNHLSPSEMNTEIARICTELA
GMADELGIRVFIFSHLNQPKGNRTHEEGAEVKESQFTGSRAMQRWCQLMIGFERNKQAS
GEEKHESRIRVIKDRNYGNTGLVFTKYNPETGCLTEREGSYDEVPEDDESPI"
gene complement(30375..30737)
/locus_tag="BN425_orf_40"
/db_xref="GeneID:14217079"
CDS complement(30375..30737)
/locus_tag="BN425_orf_40"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p41"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183248.1"
/db_xref="GI:429315998 GeneID:14217079"
/translation="MTHTDVVKAHKIYRDIPNLMKTDDEGKRQLLRRIISLMASQRQLQ
DSISASVEPATDDSDYSGYYDESAGIRFMWERLKAVEDELRLLEKQLGDFSYPYLTYPG
NVNPVPSLVLKSQLEG"
gene complement(30734..31126)
/locus_tag="BN425_orf_41"
/db_xref="GeneID:14217080"
CDS complement(30734..31126)
/locus_tag="BN425_orf_41"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p42"
/codon_start=1
/transl_table=11
/product="similar to a conserved hypotheical protein of
Vibrio cholerae"
/protein_id="YP_007183249.1"
/db_xref="GI:429315999 GeneID:14217080"
/translation="MMFVFVYGTLMHGFGNHCLLEGARFVGHATSQERGRMYSCGGFPI
LSFKHREDLVTGEVWELPGGDEGKEMLNNLDRLEGYPGWYDRSPKNFRINGEMITALVY
HQDEDQDLHIVEGADWRKFVNKRNAA"
gene complement(31123..32013)
/locus_tag="BN425_orf_42"
/db_xref="GeneID:14217081"
CDS complement(31123..32013)
/locus_tag="BN425_orf_42"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p43"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183250.1"
/db_xref="GI:429316000 GeneID:14217081"
/translation="MIYIYKGNRASNGAVALRNALGGRILRSEGSTYRGRQGSMVINWG
TQNQEAERLRRLAPIFLNNPQVVSMVTKKDEFFRHMQTVGPDLIPRWTNNFDDAVALVN
NGGGRIFVRTQLNGHSGQGVSLLVSTRDAEIQAIQQLIRSRQYPVYVMGVTNIPDEVIN
ARLFTQGIVGRRTEFRIHVVRGRAILSQVKLRRNVEENTADDSQSIVRNVAGGWVYGVN
DAEERQGHAQAVGAAIQAVNFCGLDFGAVDIVYKHETDRAYVLEINTAPGLDEGGSALE
AYTQAFTKIYEEGVI"
gene complement(32368..33921)
/locus_tag="BN425_orf_43"
/db_xref="GeneID:14217082"
CDS complement(32368..33921)
/locus_tag="BN425_orf_43"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p45"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183251.1"
/db_xref="GI:429316001 GeneID:14217082"
/translation="MCGLVGFCSTTNASDNEIALLKNLLAADIVRGAHATGLAKVDPIK
NEVSIHKMAVDAYDFLAHEDTKKFLTENRARIYIGHNRYATMGDKGDHENAHPFQVDHI
TMVHNGTVDAWGIDLLEGNDTLKVDSHMVAATIAKHGIRSTLEERFSGAAALVWWDAKE
RSLNFVRNSERPLFFAVTTTGTIVWASEDWMLKSFLERASSKIKLRGNIVELAEETLVS
IPFTEAGVRKGVEPISSPVTFLDLPIPESYRQAEKFWGNYVGADAWKQYLGEYYDDQGS
KGSQAGTQAGQKASSSRTASDEAYARNTLRINNNLRSAGSYRKHHSLLTFRIVEVQPYK
ADPGFGTVVGIDLDEGMVVEAYGLNVEALEGYTTLRGSISNAYFIGEGRDFKVVVEGVA
VSCLDPKHKASPVDGTPLQIIGTRTSPSKVLQMKSEAGNTPPANISYPLKCQGHTFVNS
YVFQDFVCRGCAVCGDIPTAYDQRNRDLTVYEGSKFTGELNECEFVCGKCVREGLSEAV"
gene complement(33934..35157)
/locus_tag="BN425_orf_44"
/db_xref="GeneID:14217083"
CDS complement(33934..35157)
/locus_tag="BN425_orf_44"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p46"
/codon_start=1
/transl_table=11
/product="similar to L-gluamine-D-fructose-6-phosphate
aminotransferase gene of Bacillus subilis"
/protein_id="YP_007183252.1"
/db_xref="GI:429316002 GeneID:14217083"
/translation="MSALYSLIGHRKRDLPEIQAHEELPAIASFGFEVELEGSDEWPRI
DGWNRKEDGSLRSGMEYIFDGPSSGAEAIQRVDRFAATMEAVKPAPTFRCSTHLHMDMR
DSSMDVLIKTVLTYMVFEDVFFDHCEPYRRDSNFCIPFFSNDWLSQTFGRRLLAVNEDG
LRIRGLMNWPKYSALNLQTVTTFGSIEFRGSHAMTSRDEMVGLMQRMLCLKAFAQGHEG
VDTSEFLEVLANVDLRDVFHLGLSPDYNMSPGGREMGLAAAALAISTGIQIANGVDPME
EEQDRQRRIREQERARRIREQERAEQNRRRAELTAAATTPLSFSEEGVNRFNIARTPGE
VSNLGNALMTVTALRGMGYQDATVRNVFDLTDEGVAAQVVQAFVMLMTDHTNYVLRTYG
VNIHQELY"
gene complement(35136..35714)
/locus_tag="BN425_orf_45"
/db_xref="GeneID:14217084"
CDS complement(35136..35714)
/locus_tag="BN425_orf_45"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p47"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183253.1"
/db_xref="GI:429316003 GeneID:14217084"
/translation="MNDLNNDHPLAGDFTMYYGNTYVFFEKDGVPHVMYVEGTEEDGDD
TRFDGFVLLGRTYTLDDNEGRYSRVRFSDVVTDSPASGYYDIHGTGFRNVYVTFAVNNR
SQKKGLDPRNFILNGIGSNGSLYPVHILRIFLQSRDMISSPSHRDFYTEEGKRVFWKGM
LVGNLVEGQLVVNDEFKKQEGLLCRLYTL"
gene complement(35707..36513)
/locus_tag="BN425_orf_46"
/db_xref="GeneID:14217085"
CDS complement(35707..36513)
/locus_tag="BN425_orf_46"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p48"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183254.1"
/db_xref="GI:429316004 GeneID:14217085"
/translation="MKNIPLIGADPEVFVGFGREPASAIGFVGGTKDEPIPVEGGALQE
DNVLLEYNIHPASSFEQFHHGITSVLNIGRDTIRPFGLEVIDNLSSHLYEEDVLRGFGD
AAFVFGCEPDYNAWTRSRNRMPTDAPPTLRTAGGHIHIGFADDLPVTKANCRAVIQACD
IYLGLASVLIDGDTDRKLLYGKAGACRYKPYGVEYRTLSNFWIFSDELIKWAYDSALKA
YSVVVEGGLDDAIAAVGGAAEVQRIINENDAVAALAALEKLGVAHE"
gene complement(36524..37657)
/locus_tag="BN425_orf_47"
/db_xref="GeneID:14217086"
CDS complement(36524..37657)
/locus_tag="BN425_orf_47"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p49"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183255.1"
/db_xref="GI:429316005 GeneID:14217086"
/translation="MALLPEQQAASSARTLREERGGAYRVDTPSPVSSDEWGTKRVLPP
QSGCNLSTPQETHGRLIMGMYAAVVIDREGRPFSQVKNLNGHTRCYGDFEDRNGEAGCV
VHFISHADNEVTRRIAVDFLNSDFVNRMTDGAILAASEDLPKEWWDGNGDLKPIGDFEL
PRAMSRFYVRVDMDKTGGPIINALRMAHMLVHSSHQPNLLQKLDPVVAVLVACARIGHN
FYCDSYVSMIPVTAGQYREQCEKEGIEVDDSYLTETMAKALGLGRIDSWGGYVQAPELL
HGPTLYDIQDIMGRTRETFKRLYSGHKDPLWQGYTKDCRAIEELGLDGYEDDDIISVSA
GITYDLNDKNREQYEVMPLDSYEDTLIQFFTENQLIK"
gene complement(37474..38598)
/locus_tag="BN425_orf_48"
/db_xref="GeneID:14217087"
CDS complement(37474..38598)
/locus_tag="BN425_orf_48"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p50"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183256.1"
/db_xref="GI:429316006 GeneID:14217087"
/translation="MAASTRPPRFLRPTRVSSSVAAPSKRALVISLGTPWGYCWLTQPR
RNKMARLKYAMNHGNSLVMMTNSSCFGALEAKYFSNWNGWFYIQARRTPKYIRQMNKMF
ADITLTVANTKVKVPKIHHWRMGSKAKSAPWNRFPNQKVFTDDRMWGNDYVCGIYMNPR
TTTPEVWYPVVKLLFKWVSSGAFDWEEEAHLELADKHGFLLSYVAMSCYNLMANGYTEH
PLRNVHGKVWKPEAVERLLKGDWEMPKVEDQGTYGRWLKQEDGTWDFILGVTPTYYDFN
KEKIEGMRKTMDKEFQITIYPQPCYLGKWEDSHWPFFQSNKLLPQHVPSVKNVGERIEL
IPPHLSRPMNGARKESFLPSLDAICQHLKKLMGD"
gene complement(38550..38879)
/locus_tag="BN425_orf_49"
/db_xref="GeneID:14217088"
CDS complement(38550..38879)
/locus_tag="BN425_orf_49"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p52"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183257.1"
/db_xref="GI:429316007 GeneID:14217088"
/translation="MTNSNGDRTQGHRRCYRTSEVTSDIYDAIYNIPAISGSPKRPPDD
DWVYYLLMVVLFISLCMAFLTPLITSKDTAYESQSLLRATENLRRADPEWRHLQGHQGS
CAPQG"
gene complement(38886..39338)
/locus_tag="BN425_orf_50"
/db_xref="GeneID:14217089"
CDS complement(38886..39338)
/locus_tag="BN425_orf_50"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p53"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183258.1"
/db_xref="GI:429316008 GeneID:14217089"
/translation="MMSESEKPIVSFEKFMQVMYDRDEYAKRLEVATAKIQELEKSLAM
ALDAAAKGDDARHQCGGMEMEIQELRDELAGLKNEVKVRTTQEVVPHFWRHRGGGRIFV
SGRLNLDTETLPFVCLETGNSWDIQPGRVEYIFELLPKGHTFTVEV"
gene complement(39328..39555)
/locus_tag="BN425_orf_51"
/db_xref="GeneID:14217090"
CDS complement(39328..39555)
/locus_tag="BN425_orf_51"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p54"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183259.1"
/db_xref="GI:429316009 GeneID:14217090"
/translation="MLKLYTRTMLVAIPLWILYLLILPYLMTSDSTSASALGAGLMVAS
IFYGLFFLKYLYNYSKRLEKKVKTLGVDDE"
gene complement(39682..40092)
/locus_tag="BN425_orf_52"
/db_xref="GeneID:14217091"
CDS complement(39682..40092)
/locus_tag="BN425_orf_52"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p55"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183260.1"
/db_xref="GI:429316010 GeneID:14217091"
/translation="MREHNFPSCCTAKIYTGMGPTSTADYQSIKDSEGFSPKKFAMDVI
QALADQYHEGEALMVFSLNNEQRVADRILSRLGSTSNPWASSDNHDTLVRVHIIRVRDT
WGKLCRENLVRYDWDHGSIPSEDFISKLVKGL"
gene complement(40089..40496)
/locus_tag="BN425_orf_53"
/db_xref="GeneID:14217092"
CDS complement(40089..40496)
/locus_tag="BN425_orf_53"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p56"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183261.1"
/db_xref="GI:429316011 GeneID:14217092"
/translation="MGSSPVLLLALVPAGDDPVLRLLQAPQGSLHISQAALQRPLQEVL
MESVIVYAAAAFFLMMCLFIFFLVAAVGVCVTLALFEDSGRIKEEHAIVIGGLWPLSLP
LILFGLMTYYLIFPMKLFIISFYKIIKGAIK"
gene complement(40361..40693)
/locus_tag="BN425_orf_54"
/db_xref="GeneID:14217093"
CDS complement(40361..40693)
/locus_tag="BN425_orf_54"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p57"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183262.1"
/db_xref="GI:429316012 GeneID:14217093"
/translation="MPPLYASLRSQRGSLLQLREGLVMTIQEILMISATIFFGLAVYGF
TSCLIYAVLEECGMRWGSDRDWAVLLSFFWPLSLPGMILYFAYYRPLKEVFISAKRLFS
GHYRRF"
gene complement(40624..40977)
/locus_tag="BN425_orf_55"
/db_xref="GeneID:14217094"
CDS complement(40624..40977)
/locus_tag="BN425_orf_55"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p58"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183263.1"
/db_xref="GI:429316013 GeneID:14217094"
/translation="MWYTTMVNSTQRRKSTCQPGCGGRMKSKPMIGQIMAQERRMKRRV
EKRGFNMTRQEGPQEPRGEIGFTLAAVGVESSRSAYLRHAREAMIQSGEDCPHCMPVFG
PKEGRCCNCARDW"
gene complement(41867..42100)
/locus_tag="BN425_orf_56"
/db_xref="GeneID:14217095"
CDS complement(41867..42100)
/locus_tag="BN425_orf_56"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p69"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183264.1"
/db_xref="GI:429316014 GeneID:14217095"
/translation="MVGPCIVAIDHQEVSVGYCIFGQVHTIQGQDYVSGFCDARVGFDA
GIVYRWTFKDGKFACGVYTLEGIRLNICGWIK"
gene complement(42158..42640)
/locus_tag="BN425_orf_57"
/db_xref="GeneID:14217096"
CDS complement(42158..42640)
/locus_tag="BN425_orf_57"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p70"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183265.1"
/db_xref="GI:429316015 GeneID:14217096"
/translation="MSDYKRINGIIKTIANRGAALDKLVQTTGMDILKHIDEHGEVSLA
CKLFNAMPQGSRRLALAHWFVDNGKIEANTDKEKAKEFPFVFAKDKATRLERAAEKPWF
KYKKERDVADEFSLDQAIAAFKAKVQRAIDKGQLQAADERIAIIQRLEVKDEAKAA"
gene complement(42651..42956)
/locus_tag="BN425_orf_58"
/db_xref="GeneID:14217097"
CDS complement(42651..42956)
/locus_tag="BN425_orf_58"
/inference="similar to DNA
sequence:RefSeq:NC_004466:PaP3p71"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_007183266.1"
/db_xref="GI:429316016 GeneID:14217097"
/translation="MTQALDKKLRRKANRKAKALGYNLGNLGKAQQRSEQKFGIIASCN
KILDDKTTSLQEKAGARKRKALMSTDWRNREVTNLRNWYKPGKCGNSAVITVEVNN"
BASE COUNT 10381 a 11520 c 11373 g 10756 t 0 other
ORIGIN
1 atattcccta aatacaccgg aggataaaat agacttttgg ggtactctca gggctataac
61 ccggatcaaa ggcaccctcc ggactatacc ttgtgttata ttgctgggat aagaagaact
121 agacccaggg tatagcgaca agagggagta gtcctaaggt atacctatag aacccggatc
181 aatagacctt ataaccccat taccagtaac ataagaaggg tagtcttagg gtatacctat
241 agaaccctat ccataccgtt cgtcgggtaa tcaggggatt tcttaagaaa agtgagaaag
301 tacttgacaa ggttacgaaa ctgtggtata atatatctat aggcacttaa gatttatctt
361 aatttactta ttacttatta aatacttaat ctatagatta tcttaagata gtcttaagaa
421 cgttaagaaa ttcccttttc cagcaaaaaa taataaaaaa agatgaaatt aggggttgac
481 aaaaaaccaa aagtgtgata taatagtatt ataaggttga gaaattaacc ttaagggtgc
541 ttaagatttc cttgggatgt agctcagttg gtagagcaga tagctgttaa ctatccggtc
601 gtaggttcga gccctaccat cccagccatt atggcccatt aactcagcgg taagagtgct
661 cccctgtcta gggagaagtc tggggttcga atccccaatg ggtcgccaac aactcctcgt
721 agctcagtct ggttagagtg cctgccttgg aagcaggagg tcgtaggttc gaatcctacc
781 ggggtgatat tagagagata ggagcgtgcg tatgtcagac gaaaaggttg tctcgattgg
841 tgccgctcct ctttctgcca aagaaaaact agacctttat tgcgaaggac tagccgatgg
901 attaaacaaa acccaagcct atgtagccgc tgggttctcc cccaatcatg ctcaacgcaa
961 cgttgcagct taccatcgga aacatgccga gtacatcaat gcctttatct cagagcgaat
1021 cgggagtcac gtccctatgg cgctccgtgt gatcgtctct attgcagaag atccaaatga
1081 gaaaggtggt atccgcctca aggcagccca ggatatcctg gaccgaggtg gcttcggtgc
1141 taagcagaaa gtggagctta ccactaagaa tgtggaagat atgtccgcag aggatctgat
1201 gaatgaagtt cgacgaatac tcgacgaaga gccagacttg gctaaagtcc tttctttccc
1261 gaccgcttga cttcctgagt cttattaaga agcgagaggg gttagtactc cagtggtaca
1321 aagactcctt gggatattgg accgggggct acggccacct acagcgtccc ggagaggatg
1381 gacccatcac cctagcccga gcagagactt ggctagagaa tgacagtcag gcagcctacg
1441 atgcagccca acggcaagta tctgagctgc ctttttgcac tccagaacta ttcgatgccc
1501 tagtgagcgt caacttccag cttggtacag catggactaa gaagttcccc aagacgtgga
1561 accttctgaa agccggagag ttcgacagag cagcttggga ggccgaggat agtgcctggg
1621 ctaaacaaac cccagttcgc gtaagggacc tccaacgagc cctttggcga gcatctacga
1681 taggtagcac ggtgacttaa tggataccca agagcggttg cgtaacctag tcagagaatt
1741 ggctgagcgg cagaagtact tccgcatgaa ccagtacacc ccctatgggt ggcaagagaa
1801 gttcattgca gcctcttcta attgtgctca gctactggct atgactggta accgctgtgg
1861 taagacatac accggggcct tcatcatggc ctgtcatctt accggtcgtt accctgagtg
1921 gtggactgga aggaaatttg acaagccagt aaactgctgg gccgcaggga tttccacaga
1981 tactactcgg gacattcttc agtctgaact attaggtgat tggaagaacc ccgaggcatt
2041 tggcactggg atgatcccca aagaggatat cgtaaagact gaacgtaggg aaggcaaacc
2101 cggatgcgtc caagctgtaa tggtaaggca cgtatctggg ggtttgtcct cgctaatctt
2161 caagtcttac gaaatgtccc aagacaaatt catgggtact gctattgacg tcatctggct
2221 tgacgaggag tgccccaagg acatttatac ccagtgtgta acccgaacgg ctactactgg
2281 gggtattgtc tatctaacct ttaccccaga gcatggcctc acggagatcg tgaaggactt
2341 cctccaggat cttaaacctg gtcagttcct gatccatgca agctgggaag atgccccaca
2401 cctcagtcca gaagttaaag agcagctact ctcggtatac tctccagcag aacgcaggat
2461 gagggctgag ggtattccta tgctcggctc tggtgtagtc ttccctattc tggaagagaa
2521 gttcgtatgt gagccttttg atatcccgga tcacttccac aggattattg gtatcgacct
2581 ggggtttgac caccctaacg ctatcgcctg tgtagcctgg gatgcagaga aggacaagta
2641 ttacctgtat gatgaacgaa gtgaatctgg cgaaaccctc ggtatgcacg ctgatgctat
2701 ctacctcaag ggtggtcacc agatccctgt tgtagtcccc cacgatgcgt ttaagcatga
2761 tggagctacc tcaggtcgtc gcttcgtaga cctcctgaag gatgaccaca acctcaacgt
2821 tgtttatgaa cccttcagca accccccagg tcctgacggt aaacacgggg gtaactccgt
2881 agagtttggt gtcaactgga tgcttactcg tatggagaat ggggatctca aggtattcaa
2941 tacttgtact aacttcctca aagaaatgaa gatgtaccac cgtaaagatg gtaagattgt
3001 ggatcgcaat gatgacatga tctcagcaac tcggtatgcc cttctgatgg cttcccgtca
3061 cgctcgtccc ggtgctgtac gaaacagtgg atactacagg agtgataccg caaggttgat
3121 ccctgattgg tttgggagta ttgtctaaat ggctaagcgt cgtaagatca agcctatgga
3181 tgatgaacag gtacttcgtc atctagacca acttgtgaat gacgctctag acttcaactc
3241 ttcggaacta tccaagcagc gttctgaggc cctaaagtat tactttggtg agcccttcgg
3301 taatgaacgc cctggtaagt ccgggattgt atctagggac gtccaagaga ccgtagactg
3361 gattatgcct tctcttatga aggtgttcac gtctggtggt caagtagtta aatatgagcc
3421 tgatactgcc gaggatgttg aacaggcaga gcaagagact gagtatgtga actacctctt
3481 catgcgtaag aacgaggggt tcaagataat gttcgactgg ttccaagaca ccctcatgat
3541 gaagactggg gttgttaagg tctatgtgga tgaggttcta aagcccacct tcgaacgatt
3601 ctcaggcctc tctgaggata tggtagcgga cattctgtct gacccagata cctctatcct
3661 ggcccaaagt gtagatgatg atggcaccta cactattaag attcgtaagg ataagaagaa
3721 gagggaaatc aaggtcctgt gtgttaagcc agagaacttc ctggtggata gactggcgac
3781 ctgtatcgat gatgcccgat tcctctgtca ccgtgagaag tacaccgtaa gcgatctccg
3841 gctcctggga gttcctgagg atgttctaga cgagctgcca tatgatgagt atgagttctc
3901 cgatagccag cctgagcgcc tagtccggga taattttgat atgacgggtc aactccagta
3961 taactctggg gatgacgctg aggctaaccg tgaggtatgg gcctctgagt gctacaccct
4021 actggacgta gatggtgatg gtatctctga actccgccgt atcctctatg taggtgatta
4081 cattatcagt aacgagcctt gggattgccg tcccttcgct gacctgaatg cctaccgtat
4141 tgcccataag ttccacggga tgagtgtcta cgataagatc cgtgacattc aagagatccg
4201 ttcggtactc atgcggaaca tcatggataa catctaccgt accaaccaag gtcgttctgt
4261 agtcttggac ggtcaggtta acttggaaga cttgctgacc aatgaggcgg ctggtatcgt
4321 ccgagttaaa tccatgaata gtattacccc tttagagact cctcagttgt ccggggaagt
4381 ctacgggatg cttgaccgcc ttgaggcaga ccggggtaag cgtactggta ttactgatcg
4441 tactcgcgga ctagatcaga acaccctgca ctctaaccaa gcggccatga gtgttaacca
4501 gttgatgact gcggctgagc aacagattga cctgattgcc cggatgtttg cagagactgg
4561 tgttaagcgt ttgttccaac ttctgcatga ccatgccatt aagtatcaga accaggaaga
4621 ggtcttccag ctacgaggca agtgggtttc cgttaaccct gccaactggc gagagaggtc
4681 tgacctgact gttactgtag gtattggtaa catgaacaaa gaccagcaga tgctccacct
4741 gatgcgtatc tgggaaatgg cccaggctgt agttgggggt ggtggtctcg gggtccttgt
4801 ctctgagcag aacctttaca acatccttaa ggaagtcaca gagaatgctg ggtacaaaga
4861 cccggatcgc ttctggacta accctaactc tcccgaggcc ctacaagcca aggcaattcg
4921 agagcagaag gaagcccaac ctaaacctga agatatcaaa gcccaagctg atgcccaacg
4981 tgcccaatcg gacgccttgg ctaagcaagc ggaggcccag atgaagcagg tagaggctca
5041 gatccgactg gctgagatcg aactgaagaa gcaagaagct gtccttcagc agagagaaat
5101 ggctcttaag gaagcggagc tacaacttga gcgtgatcgt ttcacttggg aacgggctcg
5161 taacgaagcg gagtatcatc ttgaggctac tcaggctcgg gctgcttata tcggagacgg
5221 taaagtacct gagactaaga agcctgctaa ggcagtgagg aaataacctt gggagaacgt
5281 tttggctata gtctagtgct gactgatgca gcacagcaga tggtacgtga gaacgttctt
5341 cccgagcttt tccgtattgt ccaagaggag attgagggcg aatggaaggc tacggccccc
5401 aaagatagtg agactcggga ggcgatatac cacgagctcc acgccctcaa ccgcgtacaa
5461 cttcgtatcc aggcaatctt ggattcgatc accctaaagg agtataagta atggaccttg
5521 agaatcaagg catggatgaa ttcgaggcag cggaagcctt tggtgatttg ctcggtgatg
5581 acctcctggc ccccggtgat gaaaccgtag atggtaaagt cataggtgag gaagaagagg
5641 aagaggttga aaaggaaacc cccgagggtg aatctgagga tgagcctgag gaagagcctg
5701 aggaagatcc tgaaggtgaa tccgaagagg aacctgagga aggttctgag gatgacctct
5761 cggataagct ctttgagatt ccgatcgggg atgacatcta tgaagtcaac cttgaagaac
5821 tcaagagtgg ttaccttcgc aatgaagagt ttgtaacccg tcaggctgag ctggaggaag
5881 agtatgcggc taagcttgaa tcagttgatg ctgaacgtgc taatctattg gccgagcttg
5941 agcagtatac tgttaccgct atcgctggtg ctaatcagta tgatagcata aactgggagc
6001 agcttaaagc tcaagatccg gagaagtatc agaagcttcg cctagaggct cttgaggctc
6061 gggagcaagc ccaggcactt attaaacgtc gtaacgatat caaggctatg caagagaagc
6121 gagccgagat aatccatagt tcctacatca aacgtcagac agaattggct aagaagctaa
6181 tccctgagat gactactgat gagacttggg gcgataagat cgtagcttac ggcaaatcaa
6241 ttggctactc cgaggatgaa atccggggta ttgctgatgc ccgccaactg gctgtacttg
6301 atgcagcacg taagtgggct gagtctcagg tccgtcgcaa ggctgcccta gagaagaagg
6361 aggagactga actacctgct gctgttaagc ctgtagctcg tagggcggaa gcctcagagg
6421 gttctaagcg ggttaaagct gcccgtgcta atctgaggaa agatcagtcg gttgaagccg
6481 ctgctgctct cttctcctct ctcgacattt tctaatagaa ggaagtacat tatatggcaa
6541 ctccaactaa tgccgtctcc actgtagaga tcaacggtaa gcgcgaagac cttatcgata
6601 tcatctacaa catcgctccc tatgacaccc cattcatgtc ggctatcggt aaaggcgtag
6661 caaccgctat cacccacgag tggcagactg acgagctccg tcagccgggt aagaacaccc
6721 gagttgaggg tgaggatgca accatcaagg ctggtagctt caccaccatg ctgaacaact
6781 actgccaaat ctctgacgag actctgcaag tcaccggtac tgcggataaa gtcaagaagg
6841 ctggccgtaa gaacgaactg gcttaccaat tggctaagaa gtccaaagag ttgaagctgg
6901 acatggaata cgccctggtt ggtgcccctc aggctaagat ccagcgtaac accactactc
6961 cgggtcagat ggctaacatc ttcgcctact acaagaccaa cggctccctg ggtgccaaag
7021 gtgttgcccc tataggtgac ggctcggata ccggtactgc tggtgatctg cgactgctga
7081 ccgaagatat gctcctgaac acctcggagt cgatctggcg taacggtggt caggctaact
7141 cgatccagac ttctagctcg atcaagaagg ccatcagcaa gaacatgaag ggccgtgcta
7201 ctgagatcac cctggacgct tcggataacc gcatcgcgca gaccgtagac gtctacgaga
7261 gtgacttcgg taagtacacc attcgtgcta accgttggtt ccacgagaac accctgttcg
7321 tcttcgatcc gaagatgcac agcctctgct acctgcgtcc gttcttccag catgaactgg
7381 ctaaaaccgg tgacagcgag aagcgccaac tcttggttga atacaccttc cgtgtaaaca
7441 acgagaagtc cggtgctctg atccgagacg tcgtagccca gctgtaatct agaggggccc
7501 ttcggggccc caagttttcc tataggagat catcatgagt atccaatcga cttatgcaat
7561 tgacgaagac cttgggctct ttatccgaaa ggatactcaa gatgttgagt caatcctgtc
7621 cgctaacgcc gaagagcgtc attcgggtgt aaacactaac cgtaaggata acctccgtaa
7681 ggttgctagt atcccgctgg ttgttgtaga ggcactacgg aatcgtccaa tgtctgaggg
7741 tggccccatc gatcttaacc tgattggttg cgaccctgac catgccgctc gatttacccg
7801 ttggcttaac gaccgagata actatcgtat gcggacctct gaggcacggg tataataatg
7861 gctacgatta ataacgtaac tgatctcgct attgccgcaa tccagtggtc tgaccgtcag
7921 gaccttaccc aagaacttct gatgttgttc attggcaaca ctactgaccg tctcaaccgc
7981 ctcctgcggg tacgtgagaa cgaacatttt gaaaccctga tggcctttgg tggaggcatc
8041 gagatccctg agcactttgt tgcccttcga tctatcacag gggatgcctt gatcggtgga
8101 cgtactctcc agtacatcac ccaggatgtc ttctcccact atgttaatta caactaccaa
8161 ccccaaggtg tgacttacta cactcgattg gggaacttct ggcgagtata ccctgttgtt
8221 cctgacggtg ccccgttcat tgtgaactac tggactgttc tcccagagct gagcttggct
8281 aacccaacaa cttgggccct gactaagtac ccgcagattt acctctatgg tgtccttgag
8341 cagatttatc tgtacaccat ggatgaagag cggtcgatgt tctggggaca gaaaatggaa
8401 cgggcagtca tggaactcca gaatgaagag aatgccgctg acttcgctag cactcgactg
8461 gcgatcaagg atatcgaacg ttaaggagca tccaatgcct atctttctca aaaccctcgc
8521 aatcaacctc ctggctaccc tctttccaac caaggtaatc gctaagtcca tcgtgactgg
8581 tgctaaagcc ctggctgaga agactaactc caaggttgat gacgagtttg ttaaagtcct
8641 ggaggacaat ctaaaggaga agtcggagga tgcaattact aactgataac ttgggcagca
8701 tcgtcagtgc cctggtagtt tcctcggtag tgacggtagg ttcctcggtt gtcggtcaga
8761 gtgtgcatca ggctctgctt gaacgcaaca tccaggccac ggagaagctc acccaagcgg
8821 tgagcgaact ccagatttct atggcaatct ttggggagcg gtatgtcacc cgtaaagaaa
8881 tgaaagaaga gttaaaggag gccaagaatg ggtcttgagg tcgcaacgta tatcgatcag
8941 ttggtgccta cgaaccctac cggctctgat ctgaagtcct ttggggatga ccatattcga
9001 ctcattaaga gcgccattaa gaataccttc cccaatatta accaagctgt cactgtaacg
9061 gcatcccaac tgaacgcggt cgcagacacc acccagtatg ttaaacctgg gatggttatc
9121 atgtgggcgg gtactcttgc tcagatccca gcaggttgga aactctgtaa tggtgtaggg
9181 actacctcta acggtatccc cgtacctaac cttatcgggg cattcccttg gggtatcgat
9241 ggtacatccg aagccgtagg cactcggggt ggtaacgcta atatcatatg ggatggactc
9301 accgagggtc acgctcttac gctagcccag atcccagcac acactcacac ttggcgtacc
9361 cgaggggcta ccacccttac tggttctgct ggtgattctg gtgcgttgac tggtggttct
9421 ggtaacgctg ccaataccaa cctagagact ggccctgctg gtcaagggca ggcacacacc
9481 cacactgtta agatcaacat gcccctgggc aacatcccgc cgttctgtgc tgtattcttc
9541 attattaaga actgaggtat aaaatggccc tagagagaca agaggtcaag aacccaacgg
9601 gtatcgtgac tgatattgca cccgctgacc tgcccctgga taaatggtcc ttcgggaaca
9661 acgtccggtt taagaacggt aaggctcata aggctctggg ccattccccc atctttgata
9721 ctgcccaggc acctatcttg gatatgttcc ccttcattcg gaacaacatc ccatactggc
9781 tcctgtgctc agaaaaaagg ctttacttgg cagatgggac taccatcatc gatgtgtccc
9841 caggtcaata ctctgcgagt gtaaccaacc ggtggtctgt aggttccttc aatggagtta
9901 tctttgctaa cgatggggtt aaccctcccc accacctacc accaactgag agtgtgttta
9961 gggttctacc taacttccca gcgaatacaa cctttagacg tcttaagtcc ttcaagaact
10021 tcttggttgg cttgaatgta acgtctaact ctattgaaat gccccagatg gtctggtgga
10081 gtacctcggc tgatgctggt ggtgtaccgg cctcttggga cccaacagac cctaccaaag
10141 atgctggaca gaacaccttg gctgatacca atggtgctat cgtggatggt gtgaagcttc
10201 gtgactcctt catcatctac aaggaagact ctgtatactc catgcgatat atcggtggtc
10261 tttacatctt ccaattccag caactattta atgacgtagg tatccttggt cctaactgcg
10321 ctatagagtt tgatggtaac cactttgttg taggtcatgg tgacgtctat gtccacaacg
10381 gtgtacagaa gcagtccgtg attgatgctc aggtccgtaa gttcttcttc tcggatatca
10441 acccggataa ctaccaacgg acctttgtgc tagctgacca tgtgaatact gaaatgtggg
10501 tatgctactc ctcgactcga tctgagcctg ggaagcattg cgatagggct atcatctgga
10561 actggaagga gaacacttgg agtatccgag acctccctaa cgttctcagt ggagcctatg
10621 gcatcattga ccctaagact tctaacctct gggatgacga ctccaaccac tgggataccg
10681 atacgtcggt ctggggtgaa ggttcgtata acccagcgaa gtctagtatg atcttcacgt
10741 ccttccagga tgctaaactc ttcctcttcg gggagacttc tacgttctct ggacaatcat
10801 tcacgagtac ccttgagaga tccgatatct accttgggga tgaccgaatg atgaagaccg
10861 tcagtgctgt tatacctcac attacaggca atggagtatg taatatttgg gtaggtagtg
10921 cccaggtaca aggctcaggt atccgatgga aagggcctta cccgtaccgt attgggcagg
10981 actataagat tgacaccaag catgtgggcc gatacattgc cttgaagttt gacttcgcct
11041 cagcaggtga ctggtacttc aatggatata ctttggaaat ggccccgaag gcaggtatgc
11101 gatgagtcaa aggtacagcc cctcgattcc gccacaggaa gaggaggaac tgctgccctt
11161 ccttaatgag gaattcgtta gggttggaca gactctcaat gatgtggctg atggctattg
11221 gggggtctct atggagcccc ctaagaagct taagccagga acggttaagt attttgcccc
11281 tggggtagta ggtcctgtat caggtatcta ttattatgac ttggataacc agtggaaact
11341 cgccggtact aaacccaagg atctcccagg ggattttatc ctattcaccc ctgctaataa
11401 tcatcaggct atgggcacct gtgcataccg gatgaataca gacaaggatg aagtgtggat
11461 tacccttctg gcatccggag ggaattatac tgacggtgct acagtgttgg accttcccca
11521 agcctattgg cctcctgcgg aactgttcat cccagcattt tccagtatca ttccagccca
11581 aagccagatc acttatccac caccctcaga ccccaatgca ccccctctgg atcaagtctt
11641 tgatgttctt aatcgggcta caatccaaac tgctgtggtc aaccaagcaa tgtttaagct
11701 tacggctaat ggtcgtctgc ttatccaagg aattccccaa ggtgctatct tcgggggtac
11761 gtttacttat cccctagtgg tgactccatg attcatttga ttactcgtga gaatattgaa
11821 tcccttccta ctgtagcccc tgcactagct cgggcattca ataggactga cttgggtaag
11881 ttctgggact ttgagcacct ggtacactcc ttggttaatt acgaggcctt tgtcttctac
11941 caagaggaga gtgggtatgc tggggtgttg caagtatccc aagccccttt gggcaacatc
12001 ctacacttct tctggagtgg taagatgcct gggaatgaaa ctccgataga ctaccccgag
12061 gttgatgagt acctgggaca gtttgcccag aagatgggct gtcggtttat ccaatgtgaa
12121 ggtcgtcggg gctggaagcc tacccttgag aagcttgggt acaccgagga ctccgtaacc
12181 ttctatagag aggtaactcc agatgaactt cctccaattt aatgttaaac ggctgatggg
12241 gttcaacgta gaggatgccc ttgatagtcg ggcttataag gggggtagta agaagcaaac
12301 cactacctcc acctctaccc catatcagca gggcaattac aatgaactac tctcgggtgc
12361 cagttcttgg ctacataatg ggggctttga cccgaactac ggtggtgatc cgaactttga
12421 tccagtggct gaccaaaatg ctctccaatt gggtggcatc gaggggttgg gtaatctcgg
12481 gggagccctc cagtctctcc tgggtagctc aggtgttagc tctctggctg attaccttgg
12541 tccttacgat cccaataaaa ctggcttggc gaacgccatt ggtgcagcca acgagcagat
12601 gcaatgggac ttcgacacta cggtacgccc agacctgcgt gcaggagcga ccaatgctgg
12661 ccagtatggc aggtcccgag cgggtgtagc cgagggtatt gctaccgcta ggctgctcca
12721 gaatcaacag aataacgcct ctcagttggc cttccaagac cagcagtctt acaaccagaa
12781 ccgtctgaac accctgggta atctctcggc tatcgctaag ggtttgggct ctggtaacgc
12841 catgcaggtt gatgctggat ctatgctcca gggtcaagag caacaggaaa tcaatggtgc
12901 tctccagaag tgggcatatg agaacaacgt tagtcttaac gacctcctcg cctacaagga
12961 actgatctct ggtgacatgg gtggcactaa tgtatccgtc accaaaggct ctgggggtgg
13021 tggtggtggt ctcggttctg ccctgggtgc cctaggtggt gcctccctgg gagcactctt
13081 cggaggccca gcaggagctt ctgtgggtat gaacgcaggt ggtcgagttg gaggtctgtt
13141 gttctaatgg cctctttaac tcagaagctg ttcaccattg gacagaacat cggtggtgga
13201 caggagcggg tacagttgag tcgtcaaggc tcctaccgcc ctgtccacct ggggtcggga
13261 cttagtgagg aatctagtag tggacaatca aacccttttg gcgcaatggg cggagcagca
13321 ctcgcggctc tcctcgggaa aggaagtgac tctactccag aaacagtacc aagcttttct
13381 gtcgaagggg ctaggggagc aagcgaacaa ggcgcagcaa atgttgcagc aggtatggga
13441 gcgggaatgg gcattcttcc tagcgcagaa gacctcggct ttggacaact cccaaagtca
13501 ggaatcctaa gtaaactctt tggaggttaa tcctatggcc agcatggctt atgaagggtc
13561 cccaattcgc cctagcatcc ttcgggctgc tcagaatgaa ctggatatgg cgcgaatcgc
13621 aaggaacaaa ctgccgctgg ctgtagaggg ctcaggtatt cctgatcgtg tccgtcgtgc
13681 tgctcaggca gccctggaga acccagagcg ttggtcccgt gcagcccaag aggttgcacc
13741 tgcggctgaa gctactggtc gtggtgccct tggtcgtatc gcaggtatcc ttggtggtcc
13801 tgtaggtgta ggcgttcagg ctgctgtaac ccctgccgac attggtgacc aagagcgtac
13861 tcgtgctgag gaaatggctc aagctgctca ggcagtagag aacatgggtc ctgaggttgc
13921 ccagagtgct aatcaatggg cccagggtgt aggccagagg gcagctcaga atgccacagg
13981 aggcccccaa ggagccggcc tgttgtctta tggtgttacc cctaaccaac cctctatcga
14041 gcctgagatc accccagagg tggcttccga ggctggcgct gctgtagcag atgaggggga
14101 ggctaatcgc caggtcatcc aacagggtgc agccgagggt cttcgtactg gtgctgtaag
14161 tcgtcctgaa atggcccaag ctgtagttga ggctgatgcc cagcgagaag gtgtagagct
14221 taaaccccaa gagcttaaga accgggtgaa cgaagagttg acccagatga ggactatgaa
14281 taatgatgac ctgtctcgtt atgtatctta cgctctcatt ggtactggtc ttctggcttc
14341 ggccctagac aagactggta aagccgggga tatgttcgct gcttcctatg agcgtcaatt
14401 ggatcgtaac ctacaggctg gtatcaacca acagaagatg gctgctgctg ctgctgatcg
14461 tcagatcaag gagaaggatc tggaacgcaa ggttgctaag gataagtctg atgagcgtct
14521 ggggattggt aacctagagg ttaagcgggg tactctggaa gaaacctctc ggaagaatga
14581 gggtcttctg tctaaatggg gaaaacaggc tgctgtagaa cgggccaagc ttgccctaac
14641 ccagcgtggt caagacctag ctacccaacg ggctcagctc caggctgaaa ccgctagacg
14701 tggccaggat atgtctcaag agaatgctca gctaaattct gcggtacgtc tcaagactgc
14761 caagatcagt gctgctgcac gtaaggctgc cgcttcggct tcccgtggtg aggctatcac
14821 taccaaagat gccaacgagt tggtcaaggg tgtctctggt tcggatctgg taggtggtgc
14881 taagattggt gaacaagacc agtcggctat ctcccagaag cttcggaacc atctgaggca
14941 gaatcctggg gctgacccag ttaccttcgt acagcaggaa gcggccaagc tacagaagca
15001 accgtcgggt ctttttggct ggggatcggg tattttgagt cgtcctgccc ctaagtgata
15061 aaaggtactt gacaaggtat taaaactgtg gtataataga tctataggca cttaagatta
15121 tcttaataac ttattgtatt attaattaaa tctttaggtt atcttaagat agtcttaagg
15181 tgcttatttt ctattccagc aaaaaggtga cttatggctc tttcccctga aatgaaagcc
15241 gctattgctg cggaactggc tgaggtaaaa gacctcgatg tagccgctga gttggcttcg
15301 ttgaatgagc cagaagaagt agaggtagct ccacaggaag taaccccgga ggttgtacct
15361 gaagctgccc cagacctgag cgctttggct gctccggctg atcctaattc tattggttct
15421 gcgatcaatc gtgggatcga taccatgcag tctaacatcg gtggcactat tgctactgtt
15481 ggtgagctga ctggtagtga ctacctcaaa gattacggca ctcagatggc tgaggagaat
15541 gcccaggagg cgtcacagta cggaacccca gatgttcggt cttttgccga tatccaagat
15601 attccctcca ttggttcttt cctaaagaat aatatctcag aagccctccc ctcaatggga
15661 gccgtaatgg ctggtggtgc cgcaggtgct aaggttggat ccatgtttgg tgcccctggt
15721 cgtatgggtg gtgccctcat aggttctttc ctgagctcca tggggatcaa cgtgggtgct
15781 ctgaacaacc agatgaagga gcttgacccc gagggtagta acccctggac tgctgtccta
15841 ggtggtgctg gcctctcggt actagatact gcgggtgctg gtgttatcgc tgccccactc
15901 ctcaaacaca tcggtaaaga tggcgcttac caaatgttgg tccaatcggg cctacctaag
15961 cagactgcca ttgaggctgt tactcaggct ggtaagcatg cggctgtctc tggtgtggct
16021 gagggtgtta cctctggtgc ccaacaggcc ctacaggaca ccattgctta tgatgcagta
16081 ggacaagtac aacgtccaga agagttcatg gataacctac tgacggctgc attcgctgga
16141 tctgccatgg gtgtaggtgg gggtgctgta tcctctggtc ttaacactat ggccagcaac
16201 aaggattcag caggctcagc ccataccgac cctaacgccc cttcggctgg tcctacggct
16261 tccgaaatgg agcctagggg tactatcagg aaggcctggg atgccatggg taatgaagct
16321 acggccctcc tggagccact tgctaaggcc tccccgatag cccgtgagtt ctctgagacc
16381 tttagggctg acatgagtgg tgagagggct tctggtaaga ccatcttcga ggatcaggaa
16441 ctccaggctg gtaagtggaa cactaccctg gataacatca tcgaaggcaa gtccaataag
16501 gagatccgcc agatcatcaa tgatgcctct atgggcgtca atactcctga ggctaccgcc
16561 ctccgagata tcttgaatga tgttagggct gaggctagtg gtcgaggtgg tatgtccgtt
16621 gggaatatcg tcaactatat gccctttgga ctgtcccgta agaaggtaga atcccctgag
16681 ttcctagatg atattactcc ttatttccaa gaccgtcagg ctgctgagga cgctgtagct
16741 aattggctgg cagagacttc ggatgatacc cgaggtaata ctgccccaga agttacccgc
16801 ctagtcactc agaatcagac tacaggtgct tgggaggtag atccacggta tcgtatccag
16861 ggagatcctg atacccttcg gggacggttt gcccagagtg atgcagtacc taagtatggt
16921 caactggagg aaagtcgttc ctttggatct gtacctcagg agatccttaa taaatacacc
16981 ctcaatgaat cccctaaaga cctcatccaa gagatccggg attacttcga gggatcttcc
17041 caccggattg cctttaccga gcggtttggt atcaacgggg agaaggccaa tgctatgatt
17101 gcttcggcag tagcagaggc tcaacaaaat ggtaagcgag taactaagga agaagtagac
17161 cggatgtatg acctagtgga tgcctataac ggtatgcacg gtcgtataaa agatccgaat
17221 atcaagaagc tggctgctgt agtgtctggt ggattggtct tgtctcgtct tcctttggct
17281 ggtctctcta ccctgaccga gttcagtatc ccatttgcta aggctggtcc catgactgcc
17341 ctgggtgctg ttcttccaac agtgggtgaa gttgcccgtc aggctactcg tagtgtattc
17401 agcagcattc ctaaatctga gactgggaga ctcatgagtg atatgaacca cacactggcc
17461 tctgctacct ctttgatggc agatcgggtt ggtgctgagg tattcaacca gtacactcag
17521 aaggctgtac gtgggatgtt cttggtcaac ggtctgtcca tcctgaccca tgttgaccga
17581 gtattcgcca cagagacagc caaaagggtc tatcagaaca acctcatgga cctcgccgct
17641 gggcttccct ttagctcagc taatggtgcc cttaaggttg ctcaacttag ggaaatgggt
17701 gtgaacgtga gtagccaagc ggatgccctc agattggtat ccccagcaac cccttcggag
17761 gttctgatgg ccaacaacgt taagacccta gctatccgta ggttcgtaga ccagacggtc
17821 cttgacccaa ctttcgctga caagcctatg tggatgagta atggtaacgt ccagatgttc
17881 ggacttctga agggttatcc agcagcttat ggtaacatta tcctcccgat gatgcgccgt
17941 aggttgtccc ctcacttcac tggttcttgg accaatgctg ggatgggggc tgcgggtgta
18001 gccttcacgc ttggtctgat gatgagcctg ggttacatcc aggatgaact ccgtcagatg
18061 gctaagtttg gtggctctag tcgtgaggat acccgatcag aagagcaaag gattatggat
18121 gtattgatgc aacagatgcc actccaggcc tctatgatct acgatatgct aacagcttac
18181 cggagaggta ccaccccggc agaggtactc ctgggccctg tcgcaggtgc agctaccgaa
18241 ggagctctgg ctgctggtaa gactattgca tccttcaatg atgatccttc cgctggtgag
18301 atttggaagt tcttgtataa gcaaactccg gcccgtcctt tcgttgcagg tatggaagca
18361 atggaagacg ctctggatct ataaggagaa gtatatggca acttacgttg aaactgaagc
18421 agccggccca ggtggccgag cctacgtcgt ggacgtaccc caggtattcc gtcgtaacaa
18481 ggatggggat ctcattgaga ttactgctga cgctggacga gtgaatacca acattgtaac
18541 tgctacagag ttcctcccgg actattacgc ggttaaagag aacgcagccc tggttgtaga
18601 gaacgtaact gcctcttacc ccgaccatcc ctcggaagcg gtagtcccca gcgtcctcgt
18661 gaacaccctc atcggtgccc ctggtgagac ttctggtggt aacgtagacc caggtcacgt
18721 catcggtttg ttctctgaga ctatggttga ggccccttgc ggtactgcct tcggtagtga
18781 gttccgggta gacccccgtc gggaacacct tggcgtttac gtggctatca agcacgtgat
18841 tggtccagat gaccaaaacg gtggtaccat cggtgactat attatcgagc agtttgacga
18901 catgcgaggc cctgttcaga acattggttc tctccagcag aactatcttg acccacgcct
18961 tgtgactact cacctgggtg gtaacgtagt caatactgca caactgaatg gtaacatcac
19021 acttacccga cagaactctg gtcagcactt catgagtatg tcagctacgg atatcaccgt
19081 gactttgggc cccgatgtaa ccccaggttg tgtattccac tttgtgcaag gggctgctgg
19141 taagatcaag ttcgctgtct ccccagacaa ggcttggtat gccaagggca accagactaa
19201 aactgatgct cagttcggtg aatgcaccgt ccgggtatac cccttcggag ggactgttgg
19261 ttctttcaag agtggtctct aatggaccca atgtctattc ttattcggga agtgaggtaa
19321 tctaatggca acttatattg aagatgcaaa cggtgaaagc gtattcgtga ttcagtccaa
19381 ggctattgcc gttcggaatg aagacggtac tcttcgtcat gtgatcggtc ccaaagacct
19441 taaacctgtt caatgggacg aggtggaggg gaagcctgag cttctggagg tgggatccaa
19501 ggctaacgag gctaagcctg ggaattggaa acctaaggct tccgaagttg taggtctgga
19561 tgcagtagtt aaagctgcta tcgaagaccg tatcaaggat atccccgtag catcctatca
19621 ggatagccac gaggcccttg tggataagtt taacaccctt ctgaacgccc ttcggggcta
19681 acctaaaggc cccttgggat ttacccttgg ggcctttttt tggttaggtt cagacttcta
19741 cggggtgata cttgactaca ctctcattct tggtatcagc gaagtcccga atgaagcaca
19801 tggcgtcctg tagggtttcg aagattaccg ggagggttat gtcactgagg gaggggcgga
19861 aggggtcctt atgttcactc tcaaagtttc tccaaaggaa cgccttttta tactgaggga
19921 agaagtactt tccaacttgc tttacacgat atttcataaa cttcccaccc atgacaatat
19981 ctcgaagaat agacttaaga gttctcccat cgtcaggagt aacatcagtc aactgtatcc
20041 cacatagacc agaatagcaa acaggatcga tacgaatatg tatgtccacg ggaaaccgcc
20101 tttaaccttt tgatcgttct tcatagcccc tccaatctcc atagaataca gaggatcgtt
20161 ggtccaccag atccagcata gcctccagca tttccaaccg ctctttagcc tccagagctg
20221 ccttcttgaa ggtcgctagc tttgcctcag acttagccag ttgaccctcc atttctgtca
20281 gaagatcctc tagttcagct ttcgtcatag tacaccacct tgtcgctagt cctgagtaca
20341 tactcagagt caatggtcca actcatggtt gggcatttga tccggatcat cttgggggta
20401 aacccatcga ctaccccaat ggctagatgg gaggaagtat tccggtgaac cagaaacacc
20461 accttgtccc ccacctcaag ctctcgtcct actcgatctc tcatggttac cccttgatat
20521 ccggcaggtg gatgctaggg atgtatagga tttctaggac ctcaatagag tacatacctc
20581 gggccttacc ctcagcagca ccccctctcc cgaacttcat atccagccac aactcggcgg
20641 agagaggcgt cttaaacgcc aatccccgtt gaccgaagtc atggtccgac ttgatgtagt
20701 aaatgtcagg taggaactta ctcacaggaa ctcacctaca gacattagct tgaggtcata
20761 ctcaccaccc ttgtgattac gcaggagggc tacacctcgc cagtgatcgt taccctgggg
20821 gcccttgtag gactcgtcat gggtgtagaa gctaccaact accaacccat ggatacgctc
20881 ctttcctact gcctcgatgt ggtacttgaa cccctgttcg tgtccttgga caaagctccg
20941 cttgatctta ttgaggcgat gctcggcgga accaccgtaa ggccgaccgg agttggggtt
21001 atagaagtag tgggagaagg caacaccttc gatgacaccc acgtcgagga aatcatggac
21061 aatccaatcg gacagatcaa aatgatcgta cccaataaaa ccttggagag cagggttaga
21121 gttctcatac cgcttgatac gctcctcgtg gttaccgatg aagaagtgca tttctggtcg
21181 gtagacccgc ttcttacaac tcgcttggtg actctgtagg cggcgaagag gattgagcag
21241 tagtcgcatc gcatcattac ccgcttggat atcgctgagg actcgacgtc cctcgatctt
21301 tgcggtacca cggtcgtagc ttgacaggct gggcatgtcc caatggtccc caatatgcac
21361 aattcgcttg ggacggttac gtgcgatcca ttccccgaga ttcccgaggt ggtcaacgtt
21421 gacccctggg cggacttggg tatccgcaat gacgagggta tcttcattat agcgcttact
21481 cattatggaa ggactccttg aaagtctcta gagtgaacca gcggaagcca tttcgttcgg
21541 cccactccgc catagtttgc tttgtaccat ccttgcgctt cttaagccaa tggcacgctg
21601 tatcgggctt ctcgaagatg aacacaagtt ctgtatctgg ggggagactt tccctcaccc
21661 atacatactt tgcagcctca gacgcctctt ggaagtaccc cttgacctcg accaacaaaa
21721 tcttcgtcga tgatccagtc tctaaagatg ccctgaagtc ggggtagtac ttgtgcttca
21781 ccacgtaagt gagtggttgc ggcttgaact ccatcgatgg catcgtctcg tgaacgatct
21841 tctcggtgtt ggagtcgtag ggcgtcccaa tcaatgactt cagcttgggc cggaagaatc
21901 tcccctggac gctcaatgat gttctcctct tgaagtctcc cgataacctt cagggcactc
21961 tgctgaatgt tgctaccagc caagttgacc cagtgaagga ggttatccga gagttttact
22021 ttatggtcag ggtatttctc catgacccta cggatgtggt tcacaagacg atctactgct
22081 ccatccgaga taatattctc gtgaacagtg tggccaagca aggggtcagc gatgttaatg
22141 agggtaagcc acttattacc cttgtccctg gtgtagtcag gaccgtagag taaactatgg
22201 tcaccattcc agaagctgat actgcacagg ccaatgtcga atacacatgg gtgctcctga
22261 ttacacacga tgagattaac cggaaggtgt ccctcgggga attcacaaga ctcccaaacc
22321 ttaaacgaat tggggtaatc gttattaacc tctttatccc ctaaccgtac tttcttatga
22381 ccaatggcgt tgaagaagcg gatgacgtta acttcaatgg tatcctcatc tactgccata
22441 ggaactacac ggacgcgatt acggatagcg acctcttgga gggtacgggg ctctacaacg
22501 tagatatcaa tgtccttcgg cacaaccccg ttgtcacaat cccggaggaa tccaccccca
22561 acccgaaggc cagtgaattt ggtggtttcc tctaggatct tgaagagttc ccgacatact
22621 ctaagggcct cttcaataga atagttctcc atcttcataa ggtatctccc aatgtcttat
22681 tactcggcaa ttaagctcgt taccggactg ttcaatatca aaccaattac ggtctctgat
22741 gaggtagagg agacgaaagt tctcagtaag atactccttc caattatctc catagacttt
22801 ttggtactcg taggcgcaag cctggaagag atccttctca gtagtaaggt gcccaagcaa
22861 atctgccgct gacttaggcc cgatttcagg acaacctggt atgttatcca cagagtcacc
22921 aacaaggagt tgtccataga ggaatgccgt accgtagccc tcaagcttcc aggacttttg
22981 gggcttcttc ttcccataga gtctccaaga agcggacact cgtccaaggc cctcgttacg
23041 aaagggtccc aattctggct gcttatcgcc acaggcccaa ctgtaatggt ggcactcggt
23101 gatttggcgg atatccttgt cgcgagaaca tgccgtaaag ttatccccct cctcagttcc
23161 ccgaaccccg atccaatcat cagcctcgat accgttgaca gtgactgctc cccacttacc
23221 tttaagtcgg tctgacactg tttgccagtg atgtggcttt gtatttccga cgcgagtccc
23281 cttatattgg cggatcgtcg caagctccaa tcggaaatta tcttttccag tgaggtatac
23341 ttcgtagtca tcagccccta ctctctctat gatttgttct atctttttat ctacaagctc
23401 gtggacttct tcctcgggcc atggcctaac tacctcaatg tcgaagatgt gttccttctt
23461 catagcgata tggcctagct cgtatcgaag tacgtcacca tcaatccccg cgatcatcct
23521 tagagccctc cggacctttc ttaagaatct cttcccagtg cttggtgagg gcaaatgctt
23581 cgcccttgga ccgatactcg ggatgctcta ccacagggtt ggctagagct tcgtagccct
23641 tccaatcata atactcactt tcttgacgac gggctttatc catagcatcc tccgtcaggc
23701 tgtagcctgg ggtttccccc aggtctacct caaggccttt gacagagtag ttgctgggaa
23761 ctgtcttagc cctcggatcc agcagaagtt ccattagaac tctcctcttg ttggattacc
23821 agctctaggg ctgctagggc gttccaaact tcgtgatacc ggtggggtag accactttgg
23881 gggtccagta cctcaccctt gtgtcgttca aggaggtgtc gtccgaaggc agcatcatat
23941 cgctggattc cgttctcgac gaacctccaa cccccgcgac tatatttgct tgctccgaag
24001 ttagcaactt gtgccaccgc atatagagct ctcgggaaag cttcgaagat gatcccaaca
24061 tccaccttgc ccttatcgag cttagccccc ggatctcctg ccttgattcc attgggatcc
24121 acctctacct tatcattaga tgcagctaca gaacttacca ctcgtacacc ccaaattctc
24181 tcatagtcag ctaagcagta ggggcagccc aaagggcata cccccgcctc atgatcctct
24241 aggctcttag ataggagcat cttcgtcatc gaagtcctca ccaaatacgt cctcaggctt
24301 gtcctcttcc tcggtgaaac caccaccgaa cagcggatca tcctctccat caccaccaga
24361 tacaatctcg tggagacgta caccacggag acggagggca gtgatggtac ctttaccccg
24421 agcacccttc tgggtttcga tcaggatacc aacttcacca gtagagccac cccacgggtt
24481 ggggccatca tacggcttgt tgtcgctggt caggacaatc ggcttcataa cagcggactt
24541 acgctcacca tcctgcatcc agtcaacgtg cttcttctgc ttgactttga acaggaactc
24601 accgtcacgc tcggtgtact tgatggtacc cttcagacgg gcatccttgg attccatctt
24661 ggctaccaac tcatcggcct gttccttagt cggaatgcag atggtaactt ggtaaacctc
24721 accgtattca gtatccgggg ttacaatgta ggggaagatc agcttcgcta ccggaaaggt
24781 gaatcgttgg gatactttct tagacattaa atatacctct tgtagggaag aagatattat
24841 agcacaaaag gggttttaag tcaaccccca gatgtatcag tgtgtgtcat accatgatct
24901 acctgcgata gaatcactgg caagaggaca gttacaaccc aagatttccc cagcttcctt
24961 gacacaagtc tccatgaatc cacggagagt cgcaaggtcc tcgggatggc actcccactg
25021 gccttcatcg tggatatcca aaaccttcca cgccttgagt ccagcccgtc gtaccttctc
25081 atctaggatc accattgccc acttcatgac aatagcacca gcagcttgga ggagggtgtt
25141 caatgccttg tggaccatca cctctccaga ctcactacgg cgcatcgtta gcttacgtcc
25201 gtcgagtcct acaaggtagc ccctttcggc ttcctgctta accctctcaa tcagcttagc
25261 cagctctggg ttggccttaa ggaattgctc cctcagccta gccccatcgg ccctcgtgcc
25321 accaatgatc tgcccaattt tggcatcccc agcaccgtag atgaaggcgt agatgaacgt
25381 cttagcatcg tctcgggtag gtagtcctgc ggctatttgg ttggcagtat ggacgtcacc
25441 atctacaacc tctcgggtat agtctgggtc gccaatgtag gaggcaagca tccgaagctc
25501 tagaccagca ccgtcatagc ccacgaagat cagttgattc gctgggacgt atactcggta
25561 tttgcctaca gtcttccact taccaccctt gaggacctcc acgatgttag tgtggggcct
25621 taccctttcg ttctcaccta tgtcgcggcg gaggacagtc catttccatt caccagcatt
25681 aggagtcccc tggaacaacc ctcggatttc aggcccgagg ggagaacgag cagcggggat
25741 attaactact acacggtgtc tcatacggca cgtgggtgtt gcacaggggt tagcactccc
25801 ctctaggcgt ccattaggct tcacctgctc gactaatccc tgaaggaggg agcgtctgtg
25861 agcccaaacc attcgctgca tcacaagctt accgagatcc ccctggatgg tatccatgga
25921 ggtctcagtc atcttcggag tagtgagaac cttacgttgc ttctcaagct tcctcttgac
25981 ctcaccaatg gttgtcttcc ctgggataat gccttgcagc ttcatcctca gtggcccaga
26041 gggtgagttc cggaggtctt caatgtagcg gttcaaggca ccattcagat cagatccacg
26101 tagcttcttg ccatcagtgc cgactgtaat gtccttgata ttccactggt caggtaccca
26161 cccctgagac agcatccagt ctttgaacct tgcggtttta cccaggtcaa agtccttgta
26221 ctcgattgct gtaaagggtc cagatacctc gaagtgaccc aagcgttgcc atagagcgac
26281 caagcgtttg ttcggtagac cactctttag gaatggctta ctgaatgctc ccgcttggac
26341 gatcatggga ggcatctggg ggactgcctc taggtcaatc ttgaggattc gttcgttgag
26401 tacgtggata agccacttag cccgttgagt ctggaagtag accccccgtt tactctggcg
26461 gctaatgata tcagctacct tatgctcaac gaacagtgac tttctccaat ccacttatac
26521 ccccttaaaa cgctccgcca gattctccac tactacttct acagcatcct cggagatacc
26581 ctccaggtag gagaggtaat ccacagtccc gcttcggtcc agtctccatt gctgctccag
26641 gaaggctacg gcaacctgct ttagaaggta gtcgtcgata cgctccatca gcacactttt
26701 cactttactc atgtcatcac caatcatgga cgaaggtgga tacgcccctg caaatagcaa
26761 ggtccacaag gaagttggcc aggtcaaccc tacgttgctc tttacggata cgctcctcac
26821 taccgttgtt cttcaggtag tagtggaggt tgaaaaggga gtcccgtagg aggttccgag
26881 gatcgaatgt ttcgtgacgg tcaatgtaga agtcgtcata gaggctgaga tacttgagga
26941 caacccgttg ttgcttcttg gcggaatacc gctctacttt gccatgacca ctaagataag
27001 tatagccaag gtagtttttg ggcagcttga agaagatgct acgggcagcc tggaggggta
27061 ctttgggatt catcagatag gtttggatga gtttcttacg aatctcctcc gccttagctt
27121 gggatagggc atcatttacc agcaggttac atgcgtaatg agattccatg tgtctctcct
27181 ttagatataa gagcaacccc cggcaccaca aggttattat accacagaaa gtaacttttg
27241 tcaagccctt ttgtggaaaa ccttgtcgta ccagcgatag aagtagtggg cgaaggtaat
27301 ccccagggca ccaccccaac cgctcacgaa gatgatccat ccgatatcca aatggctcga
27361 cccgactgcc ttgatgtagg caaactgagc gagggtgata caccaggaga ctacaaagcc
27421 agctttaatt ttgtcatccc tgagcagctt agagttcaac cccaagagga agacctgaaa
27481 gaatgcactc cagaagatga caaggacttg tagggttact gacatgactc acatacctcg
27541 gggtccaacc cgcaggcatt acccagctcg aagtcatcag catcgacctc tggaccaccc
27601 cagccaccgc tgaaggctgc ctctagagct gcttccttgc gggcttcatc ctggggcgta
27661 ggcttgtact tattgtccat cttctttctc ctctacggaa gtccatccac ggactgcgcc
27721 tacttctagg ctgcggttga gcaaggggtt agaatcagcc tcgccttgga agaatcgaat
27781 gatctctcct tcgatccgat agaagtcagc atagaacact ttggtgtcct gaaactgaac
27841 attgaccacg tacttcttca tcctagatcc tcaggggccc gaaggcccca cctcatttac
27901 tttttctttc gaatgccttt ggccttacga ttcccaacac gaccaccatc agcagcatta
27961 gaagagtggc tacggacacg gaggttagaa tccccgttac cgccaccatc tttaacacgt
28021 ttgatgtgat cgaccacctc gtcagacccg agtttccgtc caagacgctt ttccacctta
28081 cggcgggctc ggtgccgctg agcatctcct gacttagagc caacgcccgt ttcaccgcgt
28141 cgtatagcca gttctctttc acgcttgtaa ttcctcacac gtttagccaa gaaccagtcc
28201 tccactctac tagctcctcc caggtcatcc cgagaacctt aagcaggtag ttgaagagtg
28261 ccatactaac aactccatcc tgtaggcaat actcaaacat ttcctcggag aacttggaga
28321 agtcgttgaa atcacccttg tggcacttca ggaatcgacc ccaggctccc agcgagtgtc
28381 ccataggacg gtcaggccag gtgagtcggg aggcgaccaa ggtatcgtaa gaccgttctt
28441 ctggaatcac gataccatga agtttctcaa ggaccctgtt gtcgtagtcc aggatgttgt
28501 gcccgactac gaactttgca tgggcgatga tcctgtagaa tgtctccatt tcctcaggcc
28561 ggaatccccg gactacttga gttgggatat ctacaaggac agcgcaccaa agccttgtga
28621 cgttatcgta aagggcatca ccctctaggt cgtagataac gtaatcaaat tggggactcg
28681 tcgtcctcgg gtacttcatc atagctgcct tcacgctccg ttaggcaacc cgtttcaggg
28741 ttgtacttgg tgaacactag cccggtgtta ccgtagttcc gatccttgat gacccggata
28801 cggctctcgt gcttctcttc tccagaggct tgcttgttcc tctcgaagcc aatcatcagt
28861 tggcaccaac gctgcatcgc acggctacca gtgaattgac tttccttcac ctcagcccct
28921 tcctcgtggg tacggttacc ctttggctgg ttaaggtggg agaagatgaa tactcggata
28981 cccaactcgt cagccatccc ggccaactct gtgcagatac gagcaatctc agtgttcatt
29041 tcggagggag acaagtggtt agtcatggca gtcatgttgt caagaatgac ggtcttaaca
29101 tccatagcga ccgcccaata gcgaatacac tccttgatat gatcccaatc attctgaccc
29161 ttgttcttcc acatgaagag cttgccccga agctggccag cagcatcctt gaacgcctct
29221 acgtcccact caagatcggg ccggtggaat gccctttggg ctaccttacc tgcgatgttc
29281 ttgagtgtca tagcaacttg ctcttccaga aggaaggttc ctacgttttc cccatgttcg
29341 atgatattcc atgctgcaat gtggtgagcc agcaaggtct taccaatgcc agtaccacca
29401 cctacaccaa cgatttcacc gtcgcgctga cccatagtta gattcgtcag gccttcccag
29461 gggtaactct tgccccactt aggtggctca agggcttctg caaagacctc atctacggta
29521 acagcacagt ctggggattt caccttactg ccgaatcgaa tgagctgata gacttcatct
29581 gcccggttgc gcataagcat gtcgttagca tccttgaggg gcatttcgac aaacttacag
29641 tcagggagga gggcacggac cctctcgaca gacttgcgac cttcctcgtc agcatcgtga
29701 cagtagacaa cctcttggaa cctatcgaga atcccagatt ccttgaggaa accaatgtct
29761 cgaccagcag acccaactcc agaagaccag ctaatggatg cctgccgtag gtgtttccac
29821 ttctctggta acttactttc catgatctga gcaatcgaca tagccgaaag ctcgtcctca
29881 gagataataa gcttaaggtg tcctacgtcc ttgtgaaaga gcgtctcaag gccgaacgga
29941 tcgaccccac ccctggggct accccgatag taaaacgcct taggatccaa tatccggacg
30001 ttatacgcac ggtatttgcc atcctttgtc cgtgggtagt agtgttcgat cacatctaca
30061 ccattctcca tggacaatcc cacacgaacc ccatagcgtt ctgcgatggt tttactgatc
30121 ttgcgggagt cgagggcctt gaaggggtat tcttggacct cagcgacttc ccggaggata
30181 tcctcttcgg atttctccgt tcgcttaggt actacaaagc cctcgtccag aacctcatag
30241 tggccacaac ggttgcactt accgaagcgg ctaccttttt cttcgtcgat gaacaagatg
30301 aggtgattac ctgtgtgatc cccaccttta gctcggcaac ccggacaagc cgtatcaccg
30361 atgattttct tcatttaacc ctccagttga ctcttgagga ccagggaagg aaccgggtta
30421 acattacccg gataggtcag ataggggtag gagaagtcac ccaattgttt ctccagcagg
30481 cgcaactcat cttctacggc cttgagacgc tcccacatga agcgaatacc agcagactcg
30541 tcatagtacc cgctgtaatc cgagtcatcc gtagcaggct ctacagacgc actgatggag
30601 tcttgtagtt gtctctggga tgccatcagg ctgatgatcc gacggaggag ctgacgtttc
30661 ccctcatcat cggttttcat caggttgggg atatcacggt aaatcttgtg tgccttaact
30721 acatcagtat gggtcatgca gcattccttt tattaacaaa tttacgccag tcagcaccct
30781 cgacgatatg caggtcttga tcttcgtctt ggtggtagac aagggcggta atcatttccc
30841 cgttgatacg aaagttcttg gggctacgat cgtaccaacc cggataaccc tcaaggcgat
30901 ccaggttgtt taacatttcc ttaccttcgt ccccaccggg gagttcccac acttcacccg
30961 tgacaagatc ctcacggtgt ttgaaggaca ggatggggaa tcccccgcag gagtacatac
31021 ggcctcgctc ttgggaggtg gcatgcccga cgaatcgggc gccctccaga agacagtggt
31081 tgccgaagcc gtgcatcagt gttccataaa caaaaacaaa catcagatta cgccctcttc
31141 gtagattttg gtgaatgcct gggtgtatgc ctccagggcg ctaccccctt catccagacc
31201 cggagcagtg ttgatctcca gaacgtaggc gcggtcagtc tcgtgcttgt agacgatatc
31261 tacagcaccg aagtccaggc cacagaagtt gaccgcttgg attgctgcgc ccactgcctg
31321 agcatggccc tggcgttctt cggcatcatt gacaccgtag acccagccgc cggctacgtt
31381 gcggacgatg ctttgggagt cgtctgccgt gttctcctcg acgttacggc ggagcttaac
31441 ctgggacagg atagcccggc cacgcaccac gtggattcgg aactcggtac gacggcctac
31501 gatgccctgg gtgaacagac gagcattgat tacttcatcg gggatattcg taacacccat
31561 gacatatacc gggtactgcc tgctgcggat caactgctgg atagcctgga tttctgcatc
31621 ccgagtagac accagcaggg agaccccctg gccactatgg ccattgagtt gggtacgaac
31681 gaagatacgg ccaccaccat tattaaccaa ggcaacggcg tcatcgaagt tgttagtcca
31741 gcgagggatc aggtccgggc ctacagtttg catatggcgg aagaactcat ccttcttggt
31801 caccatcgat acaacctggg ggttgttaag gaagatgggg gccaggcgac ggagacgttc
31861 agcctcttgg ttctgagtac cccagttgat aaccatggag ccctgacggc cacggtaggt
31921 agaaccctcg gaacgaagaa ttcgtccacc cagggcattg cgaagggcta cagcaccatt
31981 ggatgcacgg ttgcctttgt agatatagat catagtgtat ctcctgtttc gttgaggtta
32041 gtgaagccag caatagcccc tgaggtccta agttgaaccc catgtacaca tcttaggaac
32101 cggcataggt cggccagggg ctattactaa cgcactacct tactcgaagt agtactcgtg
32161 gagcatatcc accgcttcgg ccaggacgat cggggcaggc accaggaatt cttcccccgg
32221 attagcctca ttcagctcct gctccttcag ccgacggata tccgccatct tatccagagt
32281 ctcttgggag aacggatact tgcgggttgc gtcggtttcc atgtggatta ctacttgacg
32341 tttgaattgc tgggtcatgt gacctcctta tactgcttcg gaaagtcctt cacggacaca
32401 tttgccacag acgaactcac actcgttaag ctcgccggtg aacttgctac cttcgtacac
32461 cgtaagatca cggttccgtt ggtcataggc tgtagggata tccccgcaga cagcgcaacc
32521 acgacataca aagtcttgga agacgtagct gttcacgaag gtatgccctt ggcacttcag
32581 tggatacgag atattcgccg gtggagtatt gccagcctcg gacttcatct gaagaacttt
32641 agaaggggat gtccgcgttc caatgatctg caacggggtc ccatccaccg gactggcctt
32701 gtgctttggg tcaaggcaac ttacggcaac accttcgacc acaactttaa aatcgcgtcc
32761 ttcaccgatg aagtaggcgt tggagatact tccacggagg gtggtgtatc cttcgagggc
32821 ttcgacgttg agtccgtagg cttcgacgac cattccttca tcgaggtcga tcccgacgac
32881 tgtaccaaag ccagggtcgg ccttgtaggg ttggacttcg acgattcgga aggtgaggag
32941 gctgtgatgc ttacggtagc ttcctgcgga tcggagattg ttgttgattc gcagggtgtt
33001 ccttgcatac gcctcatccg aagccgttct tgacgacgaa gctttttggc cagcttgcgt
33061 tcccgcttgg ctgcctttgc ttccttgatc gtcatagtac tccccgaggt attgcttcca
33121 ggcgtctgcc ccgacatagt tcccccagaa cttttctgcc tgacgataac tttctggaat
33181 cggtaggtcg agaaaggtga ccggagagct gatgggctct acacccttcc gcacgccggc
33241 ctccgtgaac gggatggata ccagagtttc ttcagccagc tccacgatgt taccgcgaag
33301 cttgattttg ctggatgcac gctccaggaa ggacttgagc atccaatcct cggatgccca
33361 tacgatggtc ccagtggtag taacagcgaa gaacagaggt cgttcagagt tacgaacgaa
33421 gttcaggctg cgctccttgg catcccacca gaccagggca gcagcacccg agaagcgttc
33481 ctccagggtg ctacgaatcc catgcttggc gatggtggct gcaaccatgt gggaatcaac
33541 cttgagggta tcgttaccct ccagcagatc gataccccag gcatccacgg tgccattgtg
33601 aaccatcgtg atgtggtcca cttggaaggg gtgagcattc tcatggtccc ctttgtcacc
33661 catggttgcg taacggttgt gtccgatgta gatgcgggca cggttttccg tgagaaactt
33721 cttggtatcc tcgtgggcca ggaagtcgta ggcatctaca gccatcttgt ggatactgac
33781 ctcgttcttg atcggatcga ccttggccaa acccgtggca tgagcaccac ggacgatatc
33841 agccgccagg aggttcttga gaagagcgat ttcattatca ctcgcgttag ttgtagaaca
33901 gaagcctact aatccgcaca taggtattac tccttagtaa agttcttggt gaatgttaac
33961 gccgtaggta cggaggacgt aattggtatg gtccgtcatc agcataacga aagcttgtac
34021 aacctgagcc gctaccccct cgtcagtgag atcgaagacg ttacggacgg ttgcatcctg
34081 ataacccata ccacgcaggg cggtcacggt catcaaggca ttacccaggt tagatacctc
34141 ccctggagtc cttgcgatgt tgaaccgatt gacaccctcc tcagagaagc tcaaaggagt
34201 tgtcgctgcc gcagtgagtt ctgcacgacg gcggttctgt tcagcacgct cttgttcacg
34261 gatgcgccgc gcacgctctt gttcacggat gcgccgctga cgatcctgct cttcctccat
34321 cgggtcaaca ccattggcga tctgaatacc cgtgctgata gccaaggcag cagccgccag
34381 acccatctca cggccacccg gagacatgtt gtagtccggg gagagcccca ggtggaacac
34441 atcccgcaga tccacattgg ccagtacctc cagaaactca gaggtgtcaa ccccttcgtg
34501 accctgggcg aaggccttga ggcagagcat acgctgcatc agcccgacca tttcatcccg
34561 agaggtcatc gcatgggagc cccggaactc gatggacccg aaggtcgtaa cggtctggag
34621 gttcagggcg gagtacttgg gccagttcat caggcctcga atccgaagac cgtcttcatt
34681 gacagccagg agacgacgac cgaaggtttg agacagccaa tcgttggaga agaaggggat
34741 acagaagttg ctatcccggc ggtagggttc acagtggtcg aagaacacat cctcgaacac
34801 catgtaggtc aggacggtct tgatgagaac atccatcgat gagtcccgca tgtccatgtg
34861 aaggtgggtg gagcagcgga aggtgggtgc cggcttgaca gcttccatgg tggcagcgaa
34921 acggtctacc cgttggattg cctctgcacc actcgaaggg ccatcgaaga tgtactccat
34981 accactgcgg agggaaccat cttccttgcg gttccaccca tcgatacggg gccattcatc
35041 ggaaccctcc agttcaacct cgaacccgaa ggacgcgatt gctgggagtt cctcatgggc
35101 ttggatctca ggaagatccc tcttgcggtg gccaatcaga gagtatagag ccgacatagc
35161 agtccctcct gtttcttgaa ttcatcattg acaaccagtt ggccttccac cagattacct
35221 accaacatac ccttccagaa gactcgcttg ccttcctcgg tgtagaagtc ccgatgggat
35281 gggctggaga tcatgtctcg ggattgcagg aagatccgga ggatatgcac cggatacagg
35341 ctgccattgc tgccaatccc gttcaggatg aagttccggg ggtccagacc tttcttctga
35401 gagcggttgt tgacagcgaa ggtgacgtaa acattacgga agcccgtccc gtgaatgtca
35461 tagtacccgc tggccggact gtcggtcact acatcactga agcgaacccg agaatatcgg
35521 ccctcgttgt catccagggt gtaggtacgt cccaggagaa cgaacccatc gaaccgggta
35581 tcgtcgccat cttcctcggt gccctcgacg tacatcacat ggggaacacc atccttctcg
35641 aagaagacat aggtgtttcc gtagtacatg gtgaagtcgc cggccagcgg atgatcgttg
35701 ttcaggtcat tcatgagcca cccccagctt ctccagggcc gccagagctg ccactgcgtc
35761 gttctcgttg atgatacgtt gtacctcggc tgcaccgcct acggctgcga tggcgtcatc
35821 caggccgcct tcgactacca cggagtaagc cttgagggcc gagtcgtatg cccacttaat
35881 caactcatcg gagaagatcc agaagttgga caaggtacga tactcgacac catagggctt
35941 gtagcggcag gcaccggcct taccgtagag cagcttacgg tcggtgtcgc cgtcgatcag
36001 caccgaggcc aggcccaggt agatatcgca ggcttggatc accgcacggc agttggcctt
36061 ggtaacaggc aggtcgtcag cgaagccgat gtggatgtga ccgccagcgg tacgaagggt
36121 cgggggtgca tcggtcggca tacggttacg gctgcgggtc caggcgttgt agtccggctc
36181 acaaccgaag acgaatgctg catcaccgaa gccacggaga acatcttcct cgtagaggtg
36241 ggaggacagg ttgtcgatga cttccaggcc gaaggggcga atggtgtcgc gtccgatgtt
36301 caggacgctg gtgatgccgt ggtggaattg ctcgaaggag ctggccggat gaatgttgta
36361 ctccagcaga acgttatcct cctgcaacgc cccaccttcc accgggatgg gctcgtcttt
36421 agtaccaccg acgaagccga tggcagatgc gggttcacga ccgaagccta cgaagacttc
36481 cgggtcagca ccaatcagag ggatattttt catggcagtt ctcctattta atcagttggt
36541 tttcggtgaa gaattgaatg agggtgtcct cgtaactatc gagaggcatt acctcatatt
36601 gctcacggtt cttgtcgttg aggtcgtaag tgatacctgc ggacacgctg atgatatcat
36661 catcctcgta cccatccagg ccgagttcct cgatagctcg gcagtctttg gtatacccct
36721 gccagagagg gtccttgtgg ccgctgtaga gacgcttgaa ggtttcccga gtacgaccca
36781 tgatatcttg gatatcgtac agggtgggcc cgtggagaag ctctggggct tgtacataac
36841 caccccaact atcaatccgc ccaaggccca aagccttggc catcgtctcc gtcaggtagg
36901 agtcatctac ctctatgccc tccttctcgc attgctcacg atactggcca gcagtcacgg
36961 ggatcatgct gacgtagctg tcgcaataga agttgtggcc aatccttgcg caggccacga
37021 ggacagcaac cacggggtcc agtttctgta gcaggttcgg ctgatggctg ctgtggacca
37081 gcatgtgggc catccgcagg gcattgatga tggggcctcc ggttttgtcc atatctaccc
37141 ggacatagaa acggctcatc gcccgtggga gttcgaagtc cccgatgggc ttgagatcac
37201 cattgccatc ccaccactcc ttggggagat cctcggacgc cgccaggata gcaccatcgg
37261 tcatcctgtt gacgaaatca ctgttgagga agtccacagc gatccttcgg gtcacttcgt
37321 tgtcagcatg ggaaatgaag tggacaacgc agcccgcttc accattcctg tcctcgaagt
37381 ccccgtagca acgggtatga ccattgaggt tcttaacttg ggagaagggt cttccctccc
37441 ggtcgattac tactgccgca tacattccca tgattaatct cccatgagtt tcttgaggtg
37501 ttgacagatt gcatccagac tggggaggaa ggactctttt cgtgccccat tcatcggacg
37561 agacaggtga gggggtatca actcgatacg ctcccccacg ttcttcacgg agggtacgtg
37621 ctgaggaagc agcttgttgc tctggaagaa gggccagtgg ctatcctccc atttccccag
37681 gtagcagggc tgagggtaga tggtgatctg gaactccttg tccatcgtct tccgcatacc
37741 ctcgatcttc tccttattga aatcatagta agtaggagta acccccagga tgaagtccca
37801 ggtgccatcc tcctgcttca accaccggcc ataggttcct tggtcttcga ccttgggcat
37861 ttcccagtcg cccttgagga gtctttcgac ggcctcgggc ttccacacct tgccgtggac
37921 gtttctcagg gggtgctcgg tgtacccatt ggccatcagg ttgtagcagg acattgccac
37981 gtaggatagg aggaatccgt gcttatcggc caactccaga tgggcctctt cctcccaatc
38041 gaacgcacca gaggataccc acttgaagag gagtttgacc acgggatacc agacctccgg
38101 ggtagtggtc cgggggttca tgtagatacc gcacacgtaa tcgttacccc acatgcggtc
38161 atcggtgaat accttctggt tggggaatcg attccagggt gcgctcttgg ccttggaccc
38221 catgcgccag tggtggatct tggggacttt taccttggtg ttggccaccg tcagggtaat
38281 gtcagcgaac atcttgttca tctggcggat gtacttgggg gtacggcgag cttggatgta
38341 gaaccaaccg ttccagttcg agaagtactt agcctccaga gcgccaaagc aggagctatt
38401 ggtcatcatg acgagggagt tcccgtggtt cattgcgtac ttgagtcgag ccatcttgtt
38461 tctccttggt tgagttagcc agcaatatcc ccagggagtt cctagggata ttactaacgc
38521 cctcttagaa ggggccgcga cgctgctgct tacccttgtg gggcgcagga accttggtgg
38581 ccttgtagat gccgccattc agggtcagct cgccggaggt tttcagtcgc tcgtagaaga
38641 ctttggcttt cataggctgt atccttgctg gtgatgaggg gagtaaggaa ggccatgcac
38701 aggctgatga agaggactac catcaggagg tagtaaaccc aatcatcatc cggtggcctc
38761 ttgggggatc cagagattgc tgggatattg tagatagcgt catatatgtc cgaagttacc
38821 tcactggtac ggtaacaccg gcggtgccct tgggtgcggt ccccattgct gttcgtcata
38881 gtacatcaga cctccaccgt gaaggtatgg cccttgggaa gtaattcgaa gatatactct
38941 acccgccctg gttgaatgtc ccaactgttg ccagtctcca ggcatacgaa gggaagcgtc
39001 tcggtgtcaa ggttcagtct gcctgacacg aagattcgac caccccctcg gtgacgccag
39061 aagtggggga ctacttcttg ggttgtacga acctttactt catttttcag tcctgccaat
39121 tcatcacgaa gttcctggat ctccatctcc attccgccgc actgatggcg agcatcatcg
39181 cccttcgctg ctgcgtcgag cgccatcgcc aatgacttct ccaattcctg gatcttggcc
39241 gtggctactt ccagacgctt agcgtactcg tcgcggtcat acataacctg catgaacttc
39301 tcgaaactga cgatgggttt ctccgactca ctcatcatcc acccccaaag tcttgacctt
39361 tttctccagt cgcttactgt agttgtacag gtacttcaag aagaagagcc catagaagat
39421 ggatgcaacc atcagaccgg cacccagggc gctagccgag gttgaatccg aggtcatcag
39481 gtaggggagg atcagaaggt agagaatcca cagagggata gccaccaaca tagtccgggt
39541 atagagcttg agcatttgat acctcacata ataagtaaga tataaaggta gaccttaagg
39601 tatcctatag gtataagagc aacccccggc accttaaggt tattatacca cacatccagc
39661 agaaagtcaa taggtcaaat gttacaaacc tttaaccaac ttgctgatga agtcctcgct
39721 cgggatggat ccgtggtccc agtcgtagcg gaccaggttc tcccggcaca gcttgcccca
39781 ggtgtcacgg acccggatga tgtggactcg cacgagggtg tcgtggttgt cgctgctggc
39841 ccaagggttg ctggtgctcc ccaggcgact gaggatacgg tcggcgaccc gctgctcatt
39901 gttcagggag aagaccatga gggcctcacc ttcgtggtac tgatcggcca gggcctggat
39961 aacatccatt gcaaacttct tggggctgaa cccctcggag tccttgatcg attggtagtc
40021 agcggtactc gtaggaccca tgccggtgta gattttggcg gtgcagcacg aggggaagtt
40081 atgctctctc atttgatggc tcctttgata attttgtaga aggatatgat gaagagtttc
40141 atcgggaaga tgaggtaata ggtcatcaac ccgaagagga tcagtgggag tgataggggc
40201 cacaacccgc caatgacgat ggcgtgctct tccttgatcc ttccgctatc ctcgaatagg
40261 gccaaggtca cgcacactcc tacggcggcc acgaggaaga agatgaagag gcacatcatg
40321 aggaagaagg ccgccgctgc atagacgatt acgctttcca ttagaacctc ctgtagtggc
40381 cgctgaagag ccgcttggct gatatgaaga cttccttgag gggcctgtag taggcgaagt
40441 acaggatcat ccccggcagg gacaagggcc agaagaagga caggagaact gcccaatcac
40501 gatctgaccc ccacctcatc ccgcactctt ccaataccgc atagatcagg caggatgtga
40561 acccgtagac cgccaacccg aagaagatag tggcggagat catgaggatt tcttggatgg
40621 tcatcaccaa tccctcgcgc agttgcagca acgaccctct ttgggaccga agactggcat
40681 acagtggggg caatcctccc cggattggat catagcctcc ctggcgtgcc gcaggtaagc
40741 cgatcggctc gactccacac ctacggctgc caaggtgaag ccaatctcac cacggggctc
40801 ctgggggcct tcctgacggg tcatgttgaa ccctcgtttc tctactcgac gcttcattcg
40861 ccgctcctgg gccatgattt ggccgatcat tggtttactc ttcatacggc ccccacatcc
40921 tggctgacac gtggacttcc ttcgctgggt agagttcacc atggttgtat accacattgg
40981 ctgcgaatga gaaaccgttc atggctacac ctcgtagcaa ttcagctcgg cagttactgg
41041 gtataccaga ctcaccggag gcatgtaaat gacgttgcca gtcttgagat tgagaacggg
41101 aacctcgtcg gattcgccct tcatcttaat gctgcggagt tcgcagacca tgtacacatc
41161 cccactgatg aggaatgttt gggacttaac cagagaactg agggttactc cgttgcgggg
41221 ccacaccttg atatccattg ggctacctca cgatgcaaaa gggatgctgt ccaaggtcga
41281 ggacaggacg aagagaacca cccacactac cagcaacaac ccattggaac gtgagcgtat
41341 ggcggcacat gcaatatact tccatgccat caccgcgccc tgttcttaac caaagatgcc
41401 cgcttggcac ggagcttgtt caactccagg gttttaccaa cgtggtttcc tccggagtta
41461 gtcaactcac ggacagcctt ggcaatcttg cggtcgatag cctcgatggc ttgcatgttg
41521 cggctaacct tacgatagtc gttgcgtttc acgggatagt ttcctttgtt gatttcccaa
41581 gactccccag cctgcgacca taggtccggt gggggtttcg gccaggaatc accatggcct
41641 catcagttgg gattagatac ccatttcctc tttccaatca cgaaagaaga agtaggcgat
41701 accgatgctg gatacaatga tagcgatggt catttgctaa gtttccttat gagttcctgg
41761 cgctcaacaa tccaccgggg atcgggatgc acccggatca tcctagtgag tttcttgaga
41821 cggttaatca tttgggcacg ttcatgggcc gcttcgtaag gtgacttcat ttgatccacc
41881 cgcagatgtt cagacggata ccttccagag tgtaaacacc gcaggcaaat ttaccgtcct
41941 tgaatgtcca gcggtacacg ataccagcgt cgaaacctac ccttgcatcg cagaaaccag
42001 aaacataatc ctggccttgg atggtatgga cctgcccaaa gatacagtaa cccacggaaa
42061 cctcctgatg gtctatcgct acaatgcacg gacctaccat gcactctagg gatagacctg
42121 gggcgcgtca tagtacacac cccaggcgca cccggcgtta cgctgccttc gcttcgtcct
42181 tgacttccag tcgttggatg atggcgatac gctcgtccgc tgcctggagc tggcccttgt
42241 cgatggcgcg ttgaaccttg gccttgaagg cggcgatggc ttggtccagg gagaactcgt
42301 cggccacgtc acgctctttc ttgtacttga accagggttt ttcggctgca cgctccagtc
42361 gagtggcctt gtccttggcg aagacgaacg ggaattcctt ggccttttcc ttgtcggtat
42421 tggcctcgat cttgccgttg tctacgaacc agtgggccag ggccagccgg cgggagcctt
42481 gcggcatcgc gttgaacagc ttgcatgcca aggacacctc gccatgctcg tcgatatgct
42541 tgaggatatc catgccggtg gtttgaacca gcttgtccag ggcagcaccc cggttggcaa
42601 tggtcttgat gatcccattg atacgcttgt agtcgctcat tgtatttacc tcagttgttt
42661 acttcgacag tgatgacggc agagttacca cacttgccag gcttatacca gttccgaagg
42721 ttagtaacct cacggttacg ccaatcggta ctcataagag ccttgcgttt acgcgcacct
42781 gccttttctt gcaacgaagt ggtcttgtcg tcgaggatct tgttacaact tgcaataatc
42841 ccaaacttct gctcactacg ctgttgggcc ttccccagat tcccaaggtt gtaacccaaa
42901 gccttggcct tgcggttggc cttgcgacgc agctttttgt caagagcctg agtcatggtc
42961 gtttcatcct ttaggaatca tcagccggga cacacatccc gatacgacaa aggggtttat
43021 cggcaaacct tggcattggc gtagccggcc cctttccgcg ttagtatcgc tgttatggtc
43081 tgtcctctgg ctatcctcgg gagtcttcgt gtctactcgt ccctaccttc gccagtatct
43141 accaagcttc gccctctgcg ctaagccatt gatactaacc caacatactc cccgtcgcgc
43201 ttgaaccacg gggtctgtca attgattgcg ctgggacagg ctaccagtcg ggccttctat
43261 ggtacaaggc caggacctac gctctttcgg agtgtgcgtt attccctcag ctttcgggtt
43321 tctcccttgt tcagtccaag gaccgtcgaa ggtacacttt ccccaggtgg ccgtcacctg
43381 atgggtgccc atgttagagg cttggacttg ccttgtcaag gctacgctaa tcccgaggga
43441 gtcatgcacg ttatgccgtt gactacgggg cgaactatac cgcttcaccg atcccttgtc
43501 aacccctgat gcctgccggt cttatacctg ggtgacttgg gcgctcttcc ctggttggca
43561 gcccccggat agcactgcgg caagggggat ggtggcctag gtagaacgtg gggccattag
43621 acccggttcc gcggggtttg tcaagcccct cggggtttcc cccggtgcct gtcggtttcc
43681 ctcaaggcgg cgccattacg ccatattctt tacggggttg tctactggtt tttcatacag
43741 tctatggact atcagtcccc cagcaaaccc ccggatatag acagtctttg actaacatag
43801 gggatcaatg gaagtcaata ggggatcaag gggttatcaa gggatattcc ccccgatcca
43861 ccccctgaat accctaagat ttttcttatg aataccctag ggtccacccg atgaacggta
43921 tccctagggg ttgacccccg gactagcctt atggtatcct ggggagggcc taggggctag
43981 tacccctggg agagggccac cccaacgtta gcctggggga ctctgggggg
//