List of phages of the species vB_PaeP_C1-14_Or_genome currently in database:

			

LOCUS HE983844 45469 bp DNA linear PHG
DEFINITION Pseudomonas phage vB_PaeP_C1-14_Or complete genome.
ACCESSION HE983844
VERSION HE983844.1 GI:410025004
DBLINK BioProject: PRJEB405
KEYWORDS complete genome.
SOURCE Pseudomonas phage vB_PaeP_C1-14_Or
ORGANISM Pseudomonas phage vB_PaeP_C1-14_Or Viruses; dsDNA viruses, no RNA
stage; Caudovirales; Podoviridae.
REFERENCE 1
AUTHORS Essoh,C., Blouin,Y., Loukou,G., Cablanmian,A., Lathro,S.,
Kutter,E., Thien,H.V., Vergnaud,G. and Pourcel,C.
TITLE The Susceptibility of Pseudomonas aeruginosa Strains from Cystic
Fibrosis Patients to Bacteriophages
JOURNAL PLoS ONE 8 (4), E60575 (2013)
PUBMED 23637754
REMARK Publication Status: Online-Only
REFERENCE 2 (bases 1 to 45469)
AUTHORS Vergnaud,G.
TITLE Direct Submission
JOURNAL Submitted (24-AUG-2012) DGA/MRIS, Mission Recherche et Innovation
Scientifique, 7-9 rue des Mathurins, F-92220 Bagneux, FRANCE
FEATURES Location/Qualifiers
source 1..45469
/organism="Pseudomonas phage vB_PaeP_C1-14_Or"
/mol_type="genomic DNA"
/strain="vB_PaeP_C1-14_Or"
/isolation_source="sewer water sample"
/host="Pseudomonas aeruginosa"
/db_xref="taxon:1229675"
/country="France:Orsay"
tRNA 553..625
/product="tRNA-Asn"
/note="codon recognized: GTT"
/anticodon=(pos:586..588,aa:Asn,seq:gtt)
tRNA 633..705
/product="tRNA-Asp"
/note="codon recognized: GTC"
/anticodon=(pos:666..668,aa:Asp,seq:gtc)
tRNA 713..787
/product="tRNA-Pro"
/note="codon recognized: TGG"
/anticodon=(pos:748..750,aa:Pro,seq:tgg)
gene 812..1270
/locus_tag="BN377_1-14_Or1_orf_01"
CDS 812..1270
/locus_tag="BN377_1-14_Or1_orf_01"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p01"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43481.1"
/db_xref="GI:410025005 UniProtKB/TrEMBL:K4RL30"
/translation="MSDEKVVSIGAAPLSAKEKLDLYCEGLADGLNKTQAYVAAGFSPN
HAQRNVAAYHRKHAEYINAFISERIGSHVPMALRVIVSIAEDPNEKGGIRLKAAQDILD
RGGFGAKQKVELTTKNVEDMSAEDLMNEVRRILDEEPDLAKVLSFPTA"
gene 1203..1700
/locus_tag="BN377_1-14_Or1_orf_02"
CDS 1203..1700
/locus_tag="BN377_1-14_Or1_orf_02"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p02"
/codon_start=1
/transl_table=11
/product="lysozyme"
/protein_id="CCM43482.1"
/db_xref="GI:410025006 GOA:K4RI04 InterPro:IPR002196
InterPro:IPR023346 InterPro:IPR023347
UniProtKB/TrEMBL:K4RI04"
/translation="MKFDEYSTKSQTWLKSFLSRPLDFLSLIKKREGLVLQWYKDSLGY
WTGGYGHLQRPGEDGPITLARAETWLENDSQAAYDAAQRQVSELPFCTPELFDALVSVN
FQLGTAWTKKFPKTWNLLKAGEFDRAAWEAEDSAWAKQTPVRVRDLQRALWRASTIGST
VT"
gene 1700..3148
/locus_tag="BN377_1-14_Or1_orf_03"
CDS 1700..3148
/locus_tag="BN377_1-14_Or1_orf_03"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p03"
/codon_start=1
/transl_table=11
/product="terminase"
/protein_id="CCM43483.1"
/db_xref="GI:410025007 InterPro:IPR004921
UniProtKB/TrEMBL:K4RLY9"
/translation="MDTQERLRNLVRELAERQKYFRMNQYTPYGWQEKFIAASSNCAQL
LAMTGNRCGKTYTGAFIMACHLTGRYPEWWTGRKFDKPVNCWAAGISTDTTRDILQSEL
LGDWKNPEAFGTGMIPKEDIVKTERREGKPGCVQAVMVRHVSGGLSSLIFKSYEMSQDK
FMGTAIDVIWLDEECPKDIYTQCVTRTATTGGIVYLTFTPEHGLTEIVKDFLQDLKPGQ
FLIHASWEDAPHLSPEVKEQLLSVYSPAERRMRAEGIPMLGSGVVFPILEEKFVCEPFD
IPDHFHRIIGIDLGFDHPNAIACVAWDAEKDKYYLYDERSESGETLGMHADAIYLKGGH
QIPVVVPHDAFKHDGATSGRRFVDLLKDDHNLNVVYEPFSNPPGPDGKHGGNSVEFGVN
WMLTRMENGDLKVFNTCTNFLKEMKMYHRKDGKIVDRNDDMISATRYALLMASRHARPG
AVRNSGYYRSDTARLIPDWFGSIV"
gene 3149..5266
/locus_tag="BN377_1-14_Or1_orf_04"
CDS 3149..5266
/locus_tag="BN377_1-14_Or1_orf_04"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p04"
/codon_start=1
/transl_table=11
/product="putative portal protein"
/protein_id="CCM43484.1"
/db_xref="GI:410025008 UniProtKB/TrEMBL:K4RKM6"
/translation="MAKRRKIKPMDDEQVLRHLDQLVNDALDFNSSELSKQRSEALKYY
FGEPFGNERPGKSGIVSRDVQETVDWIMPSLMKVFTSGGQVVKYEPDTAEDVEQAEQET
EYVNYLFMRKNEGFKIMFDWFQDTLMMKTGVVKVYVDEVLKPTFERFSGLSEDMVADIL
SDPDTSILAQSVDDDGTYTIKIRKDKKKREIKVLCVKPENFLVDRLATCIDDARFLCHR
EKYTVSDLRLLGVPEDVLDELPYDEYEFSDSQPERLVRDNFDMTGQLQYNSGDDAEANR
EVWASECYTLLDVDGDGISELRRILYVGDYIISNEPWDCRPFADLNAYRIAHKFHGMSV
YDKIRDIQEIRSVLMRNIMDNIYRTNQGRSVVLDGQVNLEDLLTNEAAGIVRVKSMNSI
TPLETPQLSGEVYGMLDRLEADRGKRTGITDRTRGLDQNTLHSNQAAMSVNQLMTAAEQ
QIDLIARMFAETGVKRLFQLLHDHAIKYQNQEEVFQLRGKWVSVNPANWRERSDLTVTV
GIGNMNKDQQMLHLMRIWEMAQAVVGGGGLGVLVSEQNLYNILKEVTENAGYKDPDRFW
TNPNSPEALQAKAIREQKEAQPKPEDIKAQADAQRAQSDALAKQAEAQMKQVEAQIRLA
EIELKKQEAVLQQREMALKEAELQLERDRFTWERARNEAEYHLEATQARAAYIGDGKVP
ETKKPAKAVRK"
gene 5511..6527
/locus_tag="BN377_1-14_Or1_orf_05"
CDS 5511..6527
/locus_tag="BN377_1-14_Or1_orf_05"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p06"
/codon_start=1
/transl_table=11
/product="putative scaffold protein"
/protein_id="CCM43485.1"
/db_xref="GI:410025009 UniProtKB/TrEMBL:K4RM66"
/translation="MDLENQGMDEFEAAEAFGDLLGDDLLAPGDETIDGKVIGEEEEEE
VEKETPEGESEDEPEEEPEEEPEEDPEGESEEEPEEGSEDDLSDKLFEIPIGDDIYEVN
LEELKSGYLRNEEFVTRQAELEEEYAAKLESVDAERANLLAELEQYTVTAIAGANQYDS
INWEQLKAQDPEKYQKLRLEALEAREQAQALIKRRNDIKAMQEKRAEIIHSSYIKRQTE
LAKKLIPEMTTDETWGDKIVAYGKSIGYSEDEIRGIADARQLAVLDAARKWAESQVRRK
AALEKKEETELPAAVKPVARRAEASEGSKRVKAARANLRKDQSVEAAAALFSSLDIF"
gene 6546..7499
/locus_tag="BN377_1-14_Or1_orf_06"
CDS 6546..7499
/locus_tag="BN377_1-14_Or1_orf_06"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p07"
/codon_start=1
/transl_table=11
/product="major head protein"
/protein_id="CCM43486.1"
/db_xref="GI:410025010 UniProtKB/TrEMBL:K4RL35"
/translation="MATPTNAVSTVEINGKREDLIDIIYNIAPYDTPFMSAIGKGVATA
ITHEWQTDELRQPGKNTRVEGEDATIKAGSFTTMLNNYCQISDETLQVTGTADKVKKAG
RKNELAYQLAKKSKELKLDMEYALVGAPQAKIQRNTTTPGQMANIFAYYKTNGSLGANG
VAPVGDGSDTGTAGDLRLLTEDMLLNTSESIWRNGGQANSIQTSSSIKKAISKNMKGRA
TEITLDASDNRIAQTVDVYESDFGKYTIRANRWFHENTLFVFDPKMHSLCYLRPFFQHE
LAKTGDSEKRQLLVEYTFRVNNEKSGALIRDVVAQL"
gene 7547..7867
/locus_tag="BN377_1-14_Or1_orf_07"
CDS 7547..7867
/locus_tag="BN377_1-14_Or1_orf_07"
/inference="similar to DNA
sequence:INSDC:NC_010325:PPLUZ24_gp61"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43487.1"
/db_xref="GI:410025011 UniProtKB/TrEMBL:K4RI05"
/translation="MSIQSTYAIDEDLGLFIRKDTQDVESILSANAEERHSGVNTNRKD
NLRKVASIPLVVVEALRNRPMSEGGPIDLNLIGCDPDHAARFTRWLNDRDNYRMRTSEA
RV"
gene 7870..8496
/locus_tag="BN377_1-14_Or1_orf_08"
CDS 7870..8496
/locus_tag="BN377_1-14_Or1_orf_08"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p09"
/codon_start=1
/transl_table=11
/product="constituent protein"
/protein_id="CCM43488.1"
/db_xref="GI:410025012 UniProtKB/TrEMBL:K4RLZ1"
/translation="MATINNVTDLAIAAIQWSDRQDLTQELLMLFIGNTTDRLNRLLRV
RENEHFETLMAFGGGIEIPEHFVALRSITGDALIGGRTLQYITQDVFSHYVNYNYQPQG
VTYYTRLGNFWRVYPVVPDGAPFIVNYWTVLPELSLANPTTWALTKYPQIYLYGVLEQI
YLYTMDEERSMFWGQKLERAVMELQNEENAADFASTRLAIKDIER"
gene 8339..8698
/locus_tag="BN377_1-14_Or1_orf_09"
CDS 8339..8698
/locus_tag="BN377_1-14_Or1_orf_09"
/inference="similar to DNA
sequence:INSDC:NC_010325:PPLUZ24_gp59"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43489.1"
/db_xref="GI:410025013 UniProtKB/TrEMBL:K4RKN0"
/translation="MVSLSRFICTPWMKSGRCSGDRNWNGQSWNSRMKRMPLTSLALDW
RSRISNVKEHPMPIFLKTLAINLLATLFPTKVIAKSIVTGAKALAEKTNSKVDDEFVKV
LEDNLKENSEDAITN"
gene 8682..8930
/locus_tag="BN377_1-14_Or1_orf_10"
CDS 8682..8930
/locus_tag="BN377_1-14_Or1_orf_10"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p11"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43490.1"
/db_xref="GI:410025014 UniProtKB/TrEMBL:K4RM69"
/translation="MQLLTDNLGSIVSALVVSSVVTVGSSVVGQSVHQALLERNIQATE
KLTQAVSELQISMAIFGERYVTRKEMKEELKEAKNGS"
gene 8920..9567
/locus_tag="BN377_1-14_Or1_orf_11"
CDS 8920..9567
/locus_tag="BN377_1-14_Or1_orf_11"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p12"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43491.1"
/db_xref="GI:410025015 UniProtKB/TrEMBL:K4RL39"
/translation="MGLEVATYIDQLVPTNPTGSDLKSFGDDHIRLIKSAIKNTFPNIN
QAVTVTASQLNAVADTTQYVKPGMVIMWAGTLAQIPAGWKLCNGVGTTSNGIPVPNLIG
AFPWGIDGTSQAVGTRGGNANIVWDGLTEGHALTLAQIPAHTHTWRTRGATTLTGSAGD
SGALTGGSGNAANTNLETGPAGQGQAHTHTVKINMPLGNIPPFCAVFFIIKN"
gene 9564..11117
/locus_tag="BN377_1-14_Or1_orf_12"
CDS 9564..11117
/locus_tag="BN377_1-14_Or1_orf_12"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p13"
/codon_start=1
/transl_table=11
/product="constituent protein"
/protein_id="CCM43492.1"
/db_xref="GI:410025016 UniProtKB/TrEMBL:K4RI06"
/translation="MRYKMALERQEVKNPTGIVTDIAPADLPLDKWSFGNNVRFKNGKA
HKALGHSPIFDTAQAPILDMFPFIRNNIPYWLLCSEKRLYLADGTTIIDVSPGQYSASV
TNRWSVGSFNGVIFANDGVNPPHHLPPTESVFRVLPNFPANTTFRRLKSFKNFLVGLNV
TSNSIEMPQMVWWSTSADAGGVPASWDPTDPTKDAGQNTLADTNGAIVDGVKLRDSFII
YKEDSVYSMRYIGGLYIFQFQQLFNDVGILGPNCAIEFDGNHFVVGHGDVYVHNGVQKQ
SVIDAQVRKFFFSDINPDNYQRTFVLADHVNTEMWVCYSSTRSEPGKHCDRAIIWNWKE
NTWSIRDLPNVLSGAYGIIDPKTSNLWDDDSNPWDTDTSVWGEGSYNPAKSSMIFTSFQ
DAKLFLFGETSTFSGQSFTSTLERSDIYLGDDRMMKTVSAVIPHITGNGVCNIWVGSAQ
VQGSGIRWKGPYPYRIGQDYKIDTKHVGRYIALKFDFASAGDWYFNGYTLEMAPKAGMR"
gene 11063..11803
/locus_tag="BN377_1-14_Or1_orf_13"
CDS 11063..11803
/locus_tag="BN377_1-14_Or1_orf_13"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p14"
/codon_start=1
/transl_table=11
/product="constituent protein"
/protein_id="CCM43493.1"
/db_xref="GI:410025017 UniProtKB/TrEMBL:K4RLZ3"
/translation="MVLQWIYFGNGPEGRYAMSQRYSPSIPPQEEEELLPFLNEEFVRV
GQTLNDVADGYWGVSMEPPKKLKPGTVKYFAPGVVGPVSGIYYYDLDNQWKLAGTKPKD
LPGDFILFTPANNHQAMGTCAYRMNTDKDEVWITLLASGGNYTDGATVLDLPQAYWPPA
ELFIPAFSSIIPAQSQITYPPPSDPNAPPLDQVFDVLNRATIQTAVVNQAMFKLTANGR
LLIQGIPQGAIFGGTFTYPLVVTP"
gene 11800..12234
/locus_tag="BN377_1-14_Or1_orf_14"
CDS 11800..12234
/locus_tag="BN377_1-14_Or1_orf_14"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p15"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43494.1"
/db_xref="GI:410025018 UniProtKB/TrEMBL:K4RKN5"
/translation="MIHLITRENIDSLPTVAPALARAFNRTDLGKFWDFEHLVHSLVNY
EAFVFYQEESGYAGVLQVSQAPLGNILHFFWSGKMPGNETPIDYPEVDEYLGQFAQKMG
CRFIQCEGRRGWKPTLEKLGYTEDSVTFYREVTPDELPPI"
gene 12215..13159
/locus_tag="BN377_1-14_Or1_orf_15"
CDS 12215..13159
/locus_tag="BN377_1-14_Or1_orf_15"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p16"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43495.1"
/db_xref="GI:410025019 UniProtKB/TrEMBL:K4RM72"
/translation="MNFLQFNVKRLMGFNVEDALDSRAYKGGSKKQTTTSTSTPYQQGN
YNELLSGASSWLHNGGFDPNYGGDPNFDPVADQNALQLGGIEGLGNLGGALQSLLGSSG
VSSLADYLGPYDPNKTGLANAIGAANEQMQWDFDTTVRPDLRAGATNAGQYGSSRAGVA
EGIATARLLQNQQNNASQLAFQDQQSYNQNRLNTLGNLSAIAKGLGSGNAMQVDAGSML
QGQEQQEINGALQKWAYENNVSLNDLLAYKELISGDMGGTNVSVTKGSGGGGGGLGSAL
GALGGASLGALFGGPAGASVGMNAGGRVGGLLF"
gene 13159..13542
/locus_tag="BN377_1-14_Or1_orf_16"
CDS 13159..13542
/locus_tag="BN377_1-14_Or1_orf_16"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p17"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43496.1"
/db_xref="GI:410025020 UniProtKB/TrEMBL:K4RL44"
/translation="MASLTQKLFTIGQNIGGGQERVQLSRQGSYRPVHLGSGLSEESSS
GQSNPFGAMGGAALAALLGKGSDSTPETVPSFSVEGARGASEQGAANVAAGMGAGMGIL
PSAEDLGFGQLPKSGILSKLFGG"
gene 13532..15070
/locus_tag="BN377_1-14_Or1_orf_17"
CDS 13532..15070
/locus_tag="BN377_1-14_Or1_orf_17"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p18"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43497.1"
/db_xref="GI:410025021 UniProtKB/TrEMBL:K4RI07"
/translation="MEVNPMASMAYEGSPIRPSILRAAQNELDMARIARNKLPLAVEGS
GIPDRVRRAAQAALENPERWSRAAQEVAPAAEATGRGALGRIAGILGGPVGVGVQAAVT
PADIGDQERTRAEEMAQAAQAVENMGPEVAQSANQWAQGVGQRAAQNATGGPQGAGLLS
YGVTPNQPSIEPEITPEVASEAGAAVADEGEANRQVIQQGAAEGLRTGAVSRPEMAQAV
VEADAQREGVELKPQELKNRVNEELTQMRTMDNDDLSRYVSYALIGTGLLASALDKTGK
AGDMFAASYERQLDRNLQAGINQQKMAAAAADRQIKEKDLERKVAKDKSDERLGIGNLE
VKRGTLEETSRKNEGLLSKWEKQAAVERAKLALTQRGQDLATQRAQLQAETARRGQDMS
QENAQLNSAVRLKTAKISAAARKAAASASRGEAITTKDANELVKGVSGSDLVGGAKIGE
QDQSAISQKLRNHLRQNPGADPVTFVQQEAAKLQKQPSGLFGWGSGILSRPAPK"
gene 15226..18396
/locus_tag="BN377_1-14_Or1_orf_18"
CDS 15226..18396
/locus_tag="BN377_1-14_Or1_orf_18"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p19"
/codon_start=1
/transl_table=11
/product="constituent protein"
/protein_id="CCM43498.1"
/db_xref="GI:410025022 UniProtKB/TrEMBL:K4RLZ5"
/translation="MALSPEMKAAIAAELAEVKDLDVAAELASLNEPEEVEVAPQEVTP
EVVPEAAPDLSALAAPADPNSIGSAINRGIDTMQSNIGGTIATVGELTGSDYLKDYGTQ
MAEENAQEASQYGTPDVRSFADIQDIPSIGSFLKNNISEALPSMGAVMAGGAAGAKVGS
MFGAPGRMGGALIGSFLSSMGINVGALNNQMKELDPEGSNPWTAVLGGAGLSVLDTAGA
GVIAAPLLKHIGKDGAYQMLVQSGLPKQTAIEAVTQAGKHAAVSGVAEGVTSGAQQALQ
DTIAYDAVGQVQRPEEFMDNLLTAAFAGSAMGVGGGAVSSGLNTMASNKDSAGSAHTDP
NAPSAAPTASEMEPRGTIRKAWDAMGNEATALLEPLAKASPIAREFSETFRADMSGERA
SGKTIFEDQELQAGKWNTTLDNIIEGKSNKEIRQIINDASMGVNTPEATALRDILNDVR
AEASGRGGMSVGNIVNYMPFGLSRKKVESPEFLDDITPYFQDRQAAEDAVANWLAETSD
DTRGNTAPEVTRLVTQNQTTGAWEVDPRYRIQGDPDTLRGRFAQSDAVPKYGQLEESRS
FGSVPQEILNKYTLNESPKDLIQEIRDYFEGSSHRIAFTERFGINGEKANAMIASAVAE
AQQNGKRVTKEEVDRMYDLVDAYNGMHGRIKDPNIKKLAAVVSGGLVLSRLPLAGLSTL
TEFSIPFAKAGPMTALGAVLPTVGEVARQATRSVFSSIPKSETGRLMSDMNHTLASATS
LMADRVGAEVFNQYTQKAVRGMFLVNGLSILTHVDRVFATETAKRVYQNNLMDLAAGLP
FSSANGALKVAQLREMGVNVSSQADALRLVSPATPSEVLMANNVKTLAIRRFVDQTVLD
PTFADKPMWMSNGNVQMFGLLKGYPAAYGNIILPMMRRRLSPHFTGSWTNAGMGAAGVA
FTLGLMMSLGYIQDELRQMAKFGGSSREDTRSEEQRIMDVLMQQMPLQASMIYDMLTAY
RRGTTPAEVLLGPVAGAATEGALAAGKTIASFNDDPSAGEIWKFLYKQTPARPFVAGME
AMEDALDL"
gene 18230..19294
/locus_tag="BN377_1-14_Or1_orf_19"
CDS 18230..19294
/locus_tag="BN377_1-14_Or1_orf_19"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p20"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43499.1"
/db_xref="GI:410025023 UniProtKB/TrEMBL:K4RKP0"
/translation="MSQVQLPKELWLLVRLLHPSMMILPLVRFGSSCISKLRPVLSLQV
WKQWKTLWIYKEKYMATYVETEAAGPGGRAYVVDVPQVFRRNKDGDLIEITADAGRVNT
NIVTATEFLPDYYAVKENAALVVENVTASYPDHPSEAVVPSVLVNTLIGAPGETSGGNV
DPGHVIGLFSETMVEAPCGTAFGSEFRVDPRREHLGVYVAIKHVIGPDDQNGGTIGDYI
IEQFDDMRGPVQNIGSLQQNYLDPRLVTTHLGGNVVNTAQLNGNITLTRQNSGQHFMSM
SATDITVTLGPDVTPGCVFHFVQGAAGKIKFAVSPDKAWYAKGNQTETDAQFGECTVRV
YPFGGTVGSFKSGL"
gene 19337..19693
/locus_tag="BN377_1-14_Or1_orf_20"
CDS 19337..19693
/locus_tag="BN377_1-14_Or1_orf_20"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p21"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43500.1"
/db_xref="GI:410025024 UniProtKB/TrEMBL:K4RM75"
/translation="MATYIEDANGESVFVIQSKAIAVRNEDGTLRHVIGPKDLKPVQWD
EVEGKPELLEVGSKANEAKPGNWKPKASEVVGLDAVVKAAIEDRIKDIPVASYQDSHEA
LVDKFNTLLNALRG"
gene complement(19742..20044)
/locus_tag="BN377_1-14_Or1_orf_21"
CDS complement(19742..20044)
/locus_tag="BN377_1-14_Or1_orf_21"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p22"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43501.1"
/db_xref="GI:410025025 UniProtKB/TrEMBL:K4RL48"
/translation="MTDVTPDDGRTLKSILRDIVMGGKFMKYRVKQVGKYFFPQYKKAF
LWRNFESEHKDPFRPSLSDITLPVIFETLQDAMCFIRDFADTKNESVVKYHPVEV"
gene complement(20114..20365)
/locus_tag="BN377_1-14_Or1_orf_22"
CDS complement(20114..20365)
/locus_tag="BN377_1-14_Or1_orf_22"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p23"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43502.1"
/db_xref="GI:410025026 UniProtKB/TrEMBL:K4RI08"
/translation="MTLSMYSGLATRWCTMTKAELEDLLTEMEGQLAKSEAKLATFKKA
ALEAKERLEMLEAMLDLVDQRSSVFYGDWRGYEERSKG"
gene complement(20307..20516)
/locus_tag="BN377_1-14_Or1_orf_23"
CDS complement(20307..20516)
/locus_tag="BN377_1-14_Or1_orf_23"
/inference="similar to DNA
sequence:INSDC:NC_010325:PPLUZ24_gp46"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43503.1"
/db_xref="GI:410025027 UniProtKB/TrEMBL:K4RLZ7"
/translation="MRDRVGRELEVGDKVVFLVHRNTSSHLAIGVVDGFTPKMIRIKCP
TMSWTIDSEYVLRTSDKVVYYDES"
gene complement(20519..20674)
/locus_tag="BN377_1-14_Or1_orf_24"
CDS complement(20519..20674)
/locus_tag="BN377_1-14_Or1_orf_24"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p24"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43504.1"
/db_xref="GI:410025028 UniProtKB/TrEMBL:K4RKP4"
/translation="MAFKTPLSAELWLDMKFGRGGAAEGKARGMYSIEVLEILYIPSIH
LPDIKG"
gene complement(20734..21495)
/locus_tag="BN377_1-14_Or1_orf_25"
CDS complement(20734..21495)
/locus_tag="BN377_1-14_Or1_orf_25"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p25"
/codon_start=1
/transl_table=11
/product="constituent protein"
/protein_id="CCM43505.1"
/db_xref="GI:410025029 UniProtKB/TrEMBL:K4RM76"
/translation="MSKRYNEDTLVIADTQVRPGVNVDHLGNLGEWIARNRPKRIVHIG
DHWDMPSLSSYDRGTAKIEGRRVLSDIQAGNDAMRLLLNPLRRLQSHQASCKKRVYRPE
MHFFIGNHEERIKRYENSNPALQGFIGYDHFDLSDWIVHDFLDVGVIEGVAFSHYFYNP
NSGRPYGGSAEHRLNKIKRSFVQGHEQGFKYHIEAVGKERIHGLVVGSFYTHDESYKGP
QGNDHWRGVALLRNHKGGEYDLKLMSVGEFL"
gene complement(21488..21928)
/locus_tag="BN377_1-14_Or1_orf_26"
CDS complement(21488..21928)
/locus_tag="BN377_1-14_Or1_orf_26"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p26"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43506.1"
/db_xref="GI:410025030 GOA:K4RL52 InterPro:IPR011578
UniProtKB/TrEMBL:K4RL52"
/translation="MSVQGRFFRPKLKSLIGTPYDSNTEKIVHETMPSMEFKPQPLTYV
VKHKYYPDFRASLETGSSTKILLVEVKGYFQEASEAAKYVWVRESLPPDTELVFIFEKP
DTACHWLKKRKDGTKQTMAEWAERNGFRWFTLETFKESFHNE"
gene complement(21690..22670)
/locus_tag="BN377_1-14_Or1_orf_27"
CDS complement(21690..22670)
/locus_tag="BN377_1-14_Or1_orf_27"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p27"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43507.1"
/db_xref="GI:410025031 UniProtKB/TrEMBL:K4RI09"
/translation="MKMENYSIEEALRVCRELFKILEETTKFTGLRVGGGFLRDCDNGV
VPKDIDIYVVEPRTLQEVAIRNRVRVVPMAVDEDTIEVNVIRFFNAIGHKKVRLGDKEV
NNDYPNSFKVWESCEFPEGHLPVNLIVCNQEHPCVFDIGLCSISFWNGDHSLLYGPDYT
RDKGNKWLTLINIADPLLGHTVHENIISDGAVDRLVNHIRRVMEKYPDHKVKLSDNLLH
WVNLAGSNIQQSALKVIGRLQEENIIERPGEILPAQAEVIDWDALRLQHREDRSRDDAI
DGVQAATTHLRGEAQVLPRLQGIFRDWIIDEDFVGRGQGVLPRGV"
gene complement(22645..23586)
/locus_tag="BN377_1-14_Or1_orf_28"
CDS complement(22645..23586)
/locus_tag="BN377_1-14_Or1_orf_28"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p28"
/codon_start=1
/transl_table=11
/product="exonuclease"
/protein_id="CCM43508.1"
/db_xref="GI:410025032 GOA:K4RLZ9 InterPro:IPR008918
InterPro:IPR020045 UniProtKB/TrEMBL:K4RLZ9"
/translation="MPSPSTGKRFLRKVRRALRMIAGIDGDVLRYELGHIAMKKEHIFD
IEVVRPWPEEEVHELVDKKIEQIIERVGADDYEVYLTGKDNFRLELATIRQYKGTRVGN
TKPHHWQTVSDRLKGKWGAVTVNGIEADDWIGVRGTEEGDNFTACSRDKDIRQITECHH
YSWACGDKQPELGPFRNEGLGRVSASWRLYGKKKPQKSWKLEGYGTAFLYGQLLVGDSV
DNIPGCPEIGPKSAADLLGHLTTEKDLFQACAYEYQKVYGDNWKEYLTENFRLLYLIRD
RNWFDIEQSGNELNCRVIRHWEIPYEDGELFY"
gene complement(23513..23806)
/locus_tag="BN377_1-14_Or1_orf_29"
CDS complement(23513..23806)
/locus_tag="BN377_1-14_Or1_orf_29"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p29"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43509.1"
/db_xref="GI:410025033 UniProtKB/TrEMBL:K4RKP8"
/translation="MELLLDPRAKTVPSNYSVKGLEVDLGETPGYSLTEDAMDKARRQE
SEYYDWKGYEALANPVVEHPEYRSKGEAFALTKHWEEILKKGPEGSKDDRGD"
gene complement(23778..24413)
/locus_tag="BN377_1-14_Or1_orf_30"
CDS complement(23778..24413)
/locus_tag="BN377_1-14_Or1_orf_30"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p30"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43510.1"
/db_xref="GI:410025034 UniProtKB/TrEMBL:K4RM77"
/translation="MPSVSVVYVSTRLYLVVMERMIRCSVVVSPRKRTSLRTYLVRTSM
TKMLLSKSLEDHEAGVCPLGCPYCLADYERIWGVRVVSSVAASNDKVEVDPNGIKAGDP
GAKLDKGKVDVGIIFEAFPRALYAVAQVANFGASKYSRGGWRFVENGIQRYDAAFGRHL
LERHKGEVLDPQSGLPHRYHEVWNALAALELVIQQEESSNGTSAGSEG"
gene complement(24259..24819)
/locus_tag="BN377_1-14_Or1_orf_31"
CDS complement(24259..24819)
/locus_tag="BN377_1-14_Or1_orf_31"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p31"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43511.1"
/db_xref="GI:410025035 InterPro:IPR012340
UniProtKB/TrEMBL:K4RL56"
/translation="MSKKVSQRFTFPVAKLIFPYIVTPDTEYGEVYQVTICIPTKEQAD
ELVAKMESKDARLKGTIKYTERDGEFLFKVKQKKHVDWMQDGERKSAVMKPIVLTSDNK
PYDGPNPWGGSTGEVGILIETQKGARGKGTITALRLRGVRLHEIVSGGDGEDDPLFGGG
FTEEEDKPEDVFGEDFDDEDAPI"
gene complement(24889..26508)
/locus_tag="BN377_1-14_Or1_orf_32"
CDS complement(24889..26508)
/locus_tag="BN377_1-14_Or1_orf_32"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p32"
/codon_start=1
/transl_table=11
/product="DNA polymerase1"
/protein_id="CCM43512.1"
/db_xref="GI:410025036 GOA:K4RI10 InterPro:IPR001098
InterPro:IPR019760 UniProtKB/TrEMBL:K4RI10"
/translation="MFVEHKVADIISRQSKRGVYFQTQRAKWLIHVLNERILKIDLEAV
PQMPPMIVQAGAFSKPFLKSGLPNKRLVALWQRLGHFEVSGPFTAIEYKDFDLGKTARF
KDWMLSQGWVPDQWNIKDITVGTDGKKLRGSDLNGALNRYIEDLRNSPSGPLRMKLQGI
IPGKTTIGEVKRKLEKQRKVLTTPKMTETSMNTIQGDLGKLVMQRMVWAHRRSLLQGLV
EQVKPNGRLEGSANPCATPTGRMRHRVVVNIPAARSPLGPEIRGLFQGTPNAGEWKWTV
LRRDIGENERVRPHTNIVEVLKGGKWKTVGKYRVYVPANQLIFVGYDGAGLELRMLASY
IGDPDYTREVVDGDVHTANQIAAGLPTRDDAKTFIYAFIYGAGDAKIGQIIGGTRADGA
RLREQFLKANPELAKLIERVKQEAERGYLVGLDGRKLTMRRSESGEVMVHKALNTLLQA
AGAIVMKWAMVILDEKVRRAGLKAWKVLDIHDEGQWECHPEDLATLRGFMETCVKEAGE
ILGCNCPLASDSIAGRSWYDTH"
gene complement(26527..26799)
/locus_tag="BN377_1-14_Or1_orf_33"
CDS complement(26527..26799)
/locus_tag="BN377_1-14_Or1_orf_33"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p33"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43513.1"
/db_xref="GI:410025037 UniProtKB/TrEMBL:K4RM01"
/translation="MTWPTSLWTLLFAGAYPPSSMIGDDMSKVKSVLMERIDDYLLKQV
AVAFLEQQWRLDRSGTVDYLSYLEGISEDAVEVVVENLAERFKGV"
gene complement(26729..27418)
/locus_tag="BN377_1-14_Or1_orf_34"
CDS complement(26729..27418)
/locus_tag="BN377_1-14_Or1_orf_34"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p34"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43514.1"
/db_xref="GI:410025038 UniProtKB/TrEMBL:K4RKQ2"
/translation="MVYHPRSVCLHQGSRVEPFGYRMVHLRERLGWCPGDYLRPILLSL
VRQGFPQKGLTKVTFCGIITLWCRGLLLYLKERHMESHYACNLLVNDALSQAKAEEIRK
KLIQTYLMNPKVPLQAARSIFFKLPKNYLGYTYLSGHGKVERYSAKKQQRVVLKYLSLY
DDFYIDRHETFDPRNLLRDSLFNLHYYLKNNGSEERIRKEQRRVDLANFLVDLAICRGV
STFVHDW"
gene complement(27528..27692)
/locus_tag="BN377_1-14_Or1_orf_35"
CDS complement(27528..27692)
/locus_tag="BN377_1-14_Or1_orf_35"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p36"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43515.1"
/db_xref="GI:410025039 UniProtKB/TrEMBL:K4RM79"
/translation="MDNKYKPTPQDEARKEAALEAAFSGGWGGPEVDADDFELGNACGL
DPEVCESCQ"
gene complement(27682..27873)
/locus_tag="BN377_1-14_Or1_orf_36"
CDS complement(27682..27873)
/locus_tag="BN377_1-14_Or1_orf_36"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p37"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43516.1"
/db_xref="GI:410025040 UniProtKB/TrEMBL:K4RL59"
/translation="MKKYVVNVQFQDTKVFYADFYRIEGEIIRFFQGEADSNPLLNRSL
EVGAVRGWTSVEEKEDGQ"
gene complement(27905..28135)
/locus_tag="BN377_1-14_Or1_orf_37"
CDS complement(27905..28135)
/locus_tag="BN377_1-14_Or1_orf_37"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p38"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43517.1"
/db_xref="GI:410025041 UniProtKB/TrEMBL:K4RI11"
/translation="MALSQEMLSGTEPAVRWKSVLDGNSGLTRWSITSNVLKMVAVTGI
LTSVSVATLLMLLMVVVLGIVRPKAFERKSK"
gene complement(28187..28714)
/locus_tag="BN377_1-14_Or1_orf_38"
CDS complement(28187..28714)
/locus_tag="BN377_1-14_Or1_orf_38"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p39"
/codon_start=1
/transl_table=11
/product="DNA polymerase2"
/protein_id="CCM43518.1"
/db_xref="GI:410025042 GOA:K4RM03 InterPro:IPR012337
UniProtKB/TrEMBL:K4RM03"
/translation="MMKYPRTTSPQFDYVIYDLEGDALYDNVTRLWCAVLVDIPTQVVR
GFRPEEMETFYRIIAHAKFVVGHNILDYDNRVLEKLHGIVIPEERSYDTLVASRLTWPD
RPMGHSLGAWGRFLKCHKGDFNDFSKFSEEMFEYCLQDGVVSMALFNYLLKVLGMTWEE
LVEWRTGSWLNV"
gene complement(28677..30386)
/locus_tag="BN377_1-14_Or1_orf_39"
CDS complement(28677..30386)
/locus_tag="BN377_1-14_Or1_orf_39"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p40"
/codon_start=1
/transl_table=11
/product="primase/helicase"
/protein_id="CCM43519.1"
/db_xref="GI:410025043 GOA:K4RKQ6 InterPro:IPR007694
UniProtKB/TrEMBL:K4RKQ6"
/translation="MKKIIGDTACPGCRAKGGDHTGNHLILFIDEEKGSRFGKCNRCGH
YEVLDEGFVVPKRTEKSEEDILREVAEVQEYPFKALDSRKISKTIAERYGVRVGLSMEN
GVDVIEHYYPRTKDGKYRAYNVRILDPKAFYYRGSPRGGVDPFGLETLFHKDVGHLKLI
ISEDELSAMSIAQIMESKLPEKWKHLRQASISWSSGVGSAGRDIGFLKESGILDRFQEV
VYCHDADEEGRKSVERVRALLPDCKFVEMPLKDANDMLMRNRADEVYQLIRFGSKVKSP
DCAVTVDEVFAEALEPPKWGKSYPWEGLTNLTMGQRDGEIVGVGGGTGIGKTLLAHHIA
AWNIIEHGENVGTFLLEEQVAMTLKNIAGKVAQRAFHRPDLEWDVEAFKDAAGQLRGKL
FMWKNKGQNDWDHIKECIRYWAVAMDVKTVILDNMTAMTNHLSPSEMNTEIARICTELA
GMADELGIRVFIFSHLNPPKGNRTHEEGAEVKESQFTGSRAMQRWCQLMIGFERNKQAS
GEEKHESRIRVIKDRNYGNTGLVFTKYNPETGCLTEREGSYDEVPEDDESPI"
gene complement(30387..30749)
/locus_tag="BN377_1-14_Or1_orf_40"
CDS complement(30387..30749)
/locus_tag="BN377_1-14_Or1_orf_40"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p41"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43520.1"
/db_xref="GI:410025044 UniProtKB/TrEMBL:K4RM82"
/translation="MTHTDVVKAHKIYRDIPNLMKTDDEGKRQLLRRIISLMASQRQLQ
DSISASVEPATDDSDYSGYYDESAGIRFMWERLKAVEDELRLLEKQLGDFSYPYLTYPG
NVNPVPSLVLKSQLEG"
gene complement(30746..31138)
/locus_tag="BN377_1-14_Or1_orf_41"
CDS complement(30746..31138)
/locus_tag="BN377_1-14_Or1_orf_41"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p42"
/codon_start=1
/transl_table=11
/product="similar to a conserved hypotheical protein of
Vibrio cholerae"
/protein_id="CCM43521.1"
/db_xref="GI:410025045 InterPro:IPR009288
InterPro:IPR013024 UniProtKB/TrEMBL:K4RL63"
/translation="MMFVFVYGTLMHGFGNHCLLEGARFVGHATSQERGRMYSCGGFPI
LSFKHREDLVTGEVWELPGGDEGKEMLNNLDRLEGYPGWYDRSPKNFRINGEMITALVY
HQDEDQDLHIVEGADWRKFVNKRNAA"
gene complement(31135..32025)
/locus_tag="BN377_1-14_Or1_orf_42"
CDS complement(31135..32025)
/locus_tag="BN377_1-14_Or1_orf_42"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p43"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43522.1"
/db_xref="GI:410025046 GOA:K4RI12 InterPro:IPR013816
UniProtKB/TrEMBL:K4RI12"
/translation="MIYIYKGNRASNGAVALRNALGGRILRSEGSTYRGRQGSMVINWG
TQNQEAERLRRLAPIFLNNPQVVSMVTKKYEFFRHMQTVGPDLIPRWTNNFDDAVALVN
NGGGRIFVRTQLNGHSGQGISLLVSTRDAEIQAIQQLIRSRQYPVYVMGVTNIPDEVIN
ARLFTQGIVGRRTEFRIHVVRGRAILSQVKLRRNVEENTADDSQSIVRNVAGGWVYGVN
DAEERQGHAQAVGAAIQAVNFCGLDFGAVDIVYKHETDRAYVLEINTAPGLDEGGSALE
AYTQAFTKIYEEGVI"
gene complement(32380..33933)
/locus_tag="BN377_1-14_Or1_orf_43"
CDS complement(32380..33933)
/locus_tag="BN377_1-14_Or1_orf_43"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p45"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43523.1"
/db_xref="GI:410025047 InterPro:IPR017932
UniProtKB/TrEMBL:K4RM05"
/translation="MCGLVGFCSTTNASDNEIALLKNLLAADIVRGAHATGLAKVDPIK
NEVSIHKMAVDAYDFLAHEDTKKFLTENRARIYIGHNRYATMGDKGDHENAHPFQVDHI
TMVHNGTVDAWGIDLLEGNDTLKVDSHMVAATIAKHGIRSTLEERFSGAAALVWWDAKE
RSLNFVRNSERPLFFAVTTTGTIVWASEDWMLKSFLERASSKIKLRGNIVELAEETLVS
IPFTEAGVRKGVEPISSPVTFLDLPIPESYRQAEKFWGNYVGADAWKQYLGEYYDDQGS
KGSQAGTQAGQKASSSRTASDEAYARNTLRINNNLRSAGSYRKHHSLLTFRIVEVQPYK
ADPGFGTVVGIDLDEGMVVEAYGLNVEALEGYTTLRGSISNAYFIGEGRDFKAVVEGVA
VSCLDPKHKASPVDGTPLQIIGTRTSPSKVLQMKSEAGNTPPANISYPLKCQGHTFVNS
YVFQDFVCRGCAVCGDIPTAYDQRNRDLTVYEGSKFTGELNECEFVCGKCVREGLSEAV"
gene complement(33946..35142)
/locus_tag="BN377_1-14_Or1_orf_44"
CDS complement(33946..35142)
/locus_tag="BN377_1-14_Or1_orf_44"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p46"
/codon_start=1
/transl_table=11
/product="similar to L-gluamine-D-fructose-6-phosphate
aminotransferase gene of Bacillus subilis"
/protein_id="CCM43524.1"
/db_xref="GI:410025048 GOA:K4RKR1 UniProtKB/TrEMBL:K4RKR1"
/translation="MSALYSLIGHRKRDLPEIQAHEELPAIASFGFEVELEGSNEWPRI
DGWNRKEDGSLRSGMEYIFDGPSSGAEAIQRVDRFAATMEAVKPAPTFRCSTHLHMDMR
DSSMDVLIKTVLTYMVFEDVFFDHCEPYRRDSNFCIPFFSNDWLSQTFGRRLLAVNEDG
LRIRGLMNWPKYSALNLQTVTTFGSIEFRGSHAMTSRDEMVGLMQRMLCLKAFAQGHEG
VDTSEFLEVLANVDLRDVFHLGLSPDYNMSPGGREMGLAAAALAISTGIQIANGVDPME
EEQDRQRRIREQERAEQNRRRAELTAAATTPLSFSEEGVNRFNIARTPGEVSNLGNALM
TVTALRGMGYQDATVRNVFDLTDEGVAAQVVQAFVMLMTDHTNYVLRTYGVNIHQELY"
gene complement(35121..35699)
/locus_tag="BN377_1-14_Or1_orf_45"
CDS complement(35121..35699)
/locus_tag="BN377_1-14_Or1_orf_45"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p47"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43525.1"
/db_xref="GI:410025049 UniProtKB/TrEMBL:K4RM84"
/translation="MNDLNNDHPLAGDFTMYYGNTYVFFEKDGVPHVMYVEGTEEDGDD
TRFDGFVLLGRTYTLDDNEGRYSRVRFSDVVTDRPASGYYDIHGTGFRNVYVTFAVNNR
SQKKGLDPRNFILNGIGSNGSLYPVHILRIFLQSRDMISSPSHRDFYTEEGKRVFWKGM
LVGNLVEGQLVVNDEFKKQEGLLCRLYTL"
gene complement(35692..36498)
/locus_tag="BN377_1-14_Or1_orf_46"
CDS complement(35692..36498)
/locus_tag="BN377_1-14_Or1_orf_46"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p48"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43526.1"
/db_xref="GI:410025050 InterPro:IPR025681
UniProtKB/TrEMBL:K4RL66"
/translation="MKNIPLIGADPEVFVGFGREPASAIGFVGGTKDEPIPVEGGALQE
DNVLLEYNIHPASSFEQFHHGITSVLNIGRDTIRPFGLEVIDNLSSHLYEEDVLRGFGD
AAFVFGCEPDYNAWTRSRNRMPTDAPPTLRTAGGHIHIGFADDLPVTKANCRAVIQACD
IYLGLASVLIDGDTDRKLLYGKAGACRYKPYGVEYRTLSNFWIFSDELIKWAYDSALKA
YSVVVEGGLDDAIAAVGGAAEVQRIINENDAVAALAALEKLGVAHE"
gene complement(36509..37642)
/locus_tag="BN377_1-14_Or1_orf_47"
CDS complement(36509..37642)
/locus_tag="BN377_1-14_Or1_orf_47"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p49"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43527.1"
/db_xref="GI:410025051 UniProtKB/TrEMBL:K4RI13"
/translation="MALLPEQQAASSARTLREERGGAYRVDTPSPVSSDEWGTKRVLPP
QSGCNLSTPQETHGRLIMGMYAAEVIDREGRPFSQVKNLNGHTRCYGDFEDRNGEAGCV
VHFISHADNEVTRRIAVDFLNSDFVNRMTDGAILAASEDLPKEWWDGNGDLKPIGDFEL
PRAMSRFYVRVDMDKTGGPIINALRMAHMLVHSSHQPNLLQKLDPVVAVLVACARIGHN
FYCDSYVSMIPVTAGQYREQCEKEGIEVDDSYLTETMAKALGLGRIDSWGDYVQAPELL
HGPTLYDIQDIMGRTQETFKRLYSGHKDPLWQGYTKDCRAIEELGLDGYEDDDIISVSA
GITYDLNDKNREQYEVMPLDSYEDTLIQFFTENQLIK"
gene complement(37459..38583)
/locus_tag="BN377_1-14_Or1_orf_48"
CDS complement(37459..38583)
/locus_tag="BN377_1-14_Or1_orf_48"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p50"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43528.1"
/db_xref="GI:410025052 UniProtKB/TrEMBL:K4RM07"
/translation="MAASTRPPRFLRPTRVSSSVAAPSKRALVISLGTPWGYCWLTQPR
RNKMARLKYAMNHGNSLVMMTNSSCFGALEAKYFSNWNGWFYIQARRTPKYIRQMNKMF
ADITLTVANTKVKVPKIHHWRMGSKAKSAPWNRFPNQKVFTDDRMWGNDYVCGIYMNPR
TTTPEVWYPVVKLLFKWVSSGAFDWEEEAHLELADKHGFLLSYVAMSCYNLMANGYTEH
PLRNVHGKVWKPEAVERLLKGDWEMPKVEDQGTYGRWLKQEDGTWDFILGVTPTYYGFN
KEKIEGMRKTMDKEFQITIYPQPCYLGKWEDSHWPFFQSNKLLPQHVPSVKNAGERIEL
IPPHLSRPMNGARKESFLPSLDAICQHLKKLMGD"
gene complement(38535..38864)
/locus_tag="BN377_1-14_Or1_orf_49"
CDS complement(38535..38864)
/locus_tag="BN377_1-14_Or1_orf_49"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p52"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43529.1"
/db_xref="GI:410025053 UniProtKB/TrEMBL:K4RKR5"
/translation="MTNSNGDRTQGHRRCYRTSEVTSDIYDAIYNIPAISGSPKRPPDD
DWVYYLLMVVLFISLCMAFLTPLITSKDTAYESQSLLRATENLRRADPEWRHLQGHQGS
CAPQG"
gene complement(38871..39323)
/locus_tag="BN377_1-14_Or1_orf_50"
CDS complement(38871..39323)
/locus_tag="BN377_1-14_Or1_orf_50"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p53"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43530.1"
/db_xref="GI:410025054 UniProtKB/TrEMBL:K4RM86"
/translation="MMSESEKPIVSFEKFMQVMYDRDEYAKRLEVATAKIQELEKSLAM
ALDAAAKGDDARHQCGGMEMEIQELRDELAGLKNEVKVRTTQEVVPHFWRHRGGGRIFV
SGRLNLDTETLPFVCLETGNSWDIQPGRVEYIFELLPKGHTFTVEV"
gene complement(39313..39540)
/locus_tag="BN377_1-14_Or1_orf_51"
CDS complement(39313..39540)
/locus_tag="BN377_1-14_Or1_orf_51"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p54"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43531.1"
/db_xref="GI:410025055 UniProtKB/TrEMBL:K4RL70"
/translation="MLKLYTRTMLVAIPLWILYLLILPYLMTSDSTSASALGAGLMVAS
IFYGLFFLKYLYNYSKRLEKKVKTLGVDDE"
gene complement(39667..40077)
/locus_tag="BN377_1-14_Or1_orf_52"
CDS complement(39667..40077)
/locus_tag="BN377_1-14_Or1_orf_52"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p55"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43532.1"
/db_xref="GI:410025056 UniProtKB/TrEMBL:K4RI14"
/translation="MREHNFPSCCTAKIYTGMGPTSTADYQSIKDSEGFSPKKFAMDVI
QALADQYHEGEALMVFSLNNEQRVADRILSRLGSTSNPWASSDNHDTLVRVHIIRVRDT
WGKLCRENLVRYDWDHGSIPSEDFISKLVKGL"
gene complement(40074..40481)
/locus_tag="BN377_1-14_Or1_orf_53"
CDS complement(40074..40481)
/locus_tag="BN377_1-14_Or1_orf_53"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p56"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43533.1"
/db_xref="GI:410025057 InterPro:IPR019689
UniProtKB/TrEMBL:K4RM09"
/translation="MGSSPVLLLALVPAGDDPVLRLLQAPQGSLHISQAALQRPLQEVL
MESVIVYAAAAFFLMMCLFIYFLVAAVGVCVTLALFEDSGRIKEEHAIVIGGLWPLSLP
LILFGLMTYYLIFPMKLFIISFYKIIKGAIK"
gene complement(40346..40678)
/locus_tag="BN377_1-14_Or1_orf_54"
CDS complement(40346..40678)
/locus_tag="BN377_1-14_Or1_orf_54"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p57"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43534.1"
/db_xref="GI:410025058 UniProtKB/TrEMBL:K4RKR9"
/translation="MPPLYASLRSQRGSLLQLREGLVMTIQEILMISATIFFGLAVYGF
TSCLIYAVLEECGMRWGSDRDWAVLLSFFWPLSLPGMILYFACYRPLKEVFISAKRLFS
GHYRRF"
gene complement(40609..40986)
/locus_tag="BN377_1-14_Or1_orf_55"
CDS complement(40609..40986)
/locus_tag="BN377_1-14_Or1_orf_55"
/inference="similar to DNA
sequence:INSDC:NC_010325:PPLUZ24_gp11"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43535.1"
/db_xref="GI:410025059 UniProtKB/TrEMBL:K4RM89"
/translation="MVSPSSQPMWYTTMVNSTQRRKSTCQPGCGGRMKSKPMIGQIMAQ
ERRMKRRVEKRGFNMTRQEGPQEPRGEIGFTLAAVGVESSRSAYLRHAREAMIQSGEDC
PHCMPVFGPKEGRCCNCARDW"
gene complement(40880..41125)
/locus_tag="BN377_1-14_Or1_orf_56"
CDS complement(40880..41125)
/locus_tag="BN377_1-14_Or1_orf_56"
/inference="similar to DNA
sequence:INSDC:NC_010325:PPLUZ24_gp10"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43536.1"
/db_xref="GI:410025060 UniProtKB/TrEMBL:K4RL75"
/translation="MTTFTVAVSQPRSDLHISKRKDGVYVSLTGDSVYLKQGGTVTIIT
KVGFSIFAANVVYNHGELYPAKEVHVSARMWGPYEE"
gene complement(41433..41708)
/locus_tag="BN377_1-14_Or1_orf_57"
CDS complement(41433..41708)
/locus_tag="BN377_1-14_Or1_orf_57"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p61"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43537.1"
/db_xref="GI:410025061 UniProtKB/TrEMBL:K4RI15"
/translation="MKLNYNMLTSKIRVASWDDLESGRLYIRQDEDGAANPRVFMYMEV
ADEFFIVDIFGGPVGAVYFSGDVDCGFYPVTIKAASIEVHRFGPPA"
gene complement(41710..41994)
/locus_tag="BN377_1-14_Or1_orf_58"
CDS complement(41710..41994)
/locus_tag="BN377_1-14_Or1_orf_58"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p62"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43538.1"
/db_xref="GI:410025062 UniProtKB/TrEMBL:K4RM11"
/translation="MMPTSSRGCKVIVTKGCSNGSVGVFKKKVVIGRHMVFVYQNVCYI
YQGGTPWCKTPTLSSAKAMINNYEVAVKDSSNRVKDMFGDLMVIPIEEV"
gene complement(41966..42214)
/locus_tag="BN377_1-14_Or1_orf_59"
CDS complement(41966..42214)
/locus_tag="BN377_1-14_Or1_orf_59"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p63"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43539.1"
/db_xref="GI:410025063 UniProtKB/TrEMBL:K4RKS4"
/translation="MMGLPKDKVSVLEDGTVYVPWRYHLSSLYNMASLGGATDPEAVKD
EFLDYLRAEYGRYVTFELEGIPEDREDSFDAYVLKGV"
gene complement(42211..42459)
/locus_tag="BN377_1-14_Or1_orf_60"
CDS complement(42211..42459)
/locus_tag="BN377_1-14_Or1_orf_60"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p64"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43540.1"
/db_xref="GI:410025064 UniProtKB/TrEMBL:K4RM91"
/translation="MLRGVAMNGFSFAAIILSGLAIGWVIGATTVVRKNAPVDVSRGEV
VGKMDGVSIYRLYDLEEGAVCYGTYRGLSCLRLVKTP"
gene complement(42444..42677)
/locus_tag="BN377_1-14_Or1_orf_61"
CDS complement(42444..42677)
/locus_tag="BN377_1-14_Or1_orf_61"
/inference="similar to DNA
sequence:INSDC:NC_010325:PPLUZ24_gp07"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43541.1"
/db_xref="GI:410025065 UniProtKB/TrEMBL:K4RL79"
/translation="MDIKVWPRNGVTLSSLVKSQTFLISGDVYMVCELRSIKMKGESDE
VPVLNLKTGNVIYMPPVSLVYPVTAELNCYEV"
gene complement(43306..43539)
/locus_tag="BN377_1-14_Or1_orf_62"
CDS complement(43306..43539)
/locus_tag="BN377_1-14_Or1_orf_62"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p69"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43542.1"
/db_xref="GI:410025066 UniProtKB/TrEMBL:K4RI16"
/translation="MVGPCIVAIDHQEVSVGYCIFGQVHTIQGQDYVSGFCDARVGFDA
GIVYRWTFKDGKFACGVYTLEGIRLNICGWIK"
gene complement(43597..44079)
/locus_tag="BN377_1-14_Or1_orf_63"
CDS complement(43597..44079)
/locus_tag="BN377_1-14_Or1_orf_63"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p70"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43543.1"
/db_xref="GI:410025067 UniProtKB/TrEMBL:K4RM13"
/translation="MSDYKRINGIIKTIANRGAALDKLVQTTGMDILKHIDEHGEVSLA
CKLFNAMPQGSRRLALAHWFVDNGKIEANTDKEKAKEFPFVFAKDKATRLERAAEKPWF
KYKKERDVADEFSLDQAIAAFKAKVQRAIDKGQLQAADERIAIIQRLEVKDEAKAA"
gene complement(44090..44395)
/locus_tag="BN377_1-14_Or1_orf_64"
CDS complement(44090..44395)
/locus_tag="BN377_1-14_Or1_orf_64"
/inference="similar to DNA sequence:INSDC:NC_004466:PaP3p71"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="CCM43544.1"
/db_xref="GI:410025068 UniProtKB/TrEMBL:K4RKS9"
/translation="MTQALDKKLRRKANRKAKALGYNLGNLGKAQQRSEQKFGIIASCN
KILDDKTTSLQEKAGARKRKALMSTDWRNREVTNLRNWYKPGKCGNSAVITVEVNN"
BASE COUNT 10731 a 11915 c 11729 g 11094 t 0 other
ORIGIN
1 atattcccta aatacaccgg aggataaaat agacttttgg ggtactctca gggctataac
61 ccggatcaaa ggcaccctcc ggactatacc ttgtgttata ttgctgggat aagaagaact
121 agacccaggg tatagcgaca agagggagta gtcctaaggt atacctatag aacccggatc
181 aatagacctt ataaccccat taccagtaac ataagaaggg tagtcttagg gtatacctat
241 agaaccctat ccataccgtt cgtcgggtaa tcaggggatt tcttaagaaa agtgagaaag
301 tacttgacaa ggttacgaaa ctgtggtata atatatctat aggcacttaa gatttatctt
361 aatttactta ttacttatta aatacttaat ctatagatta tcttaagata gtcttaagaa
421 ctttaagaaa ttcccttttc cagcaaaaaa taataaaaaa agatgaaatt aggggttgac
481 aaaaaaccaa aagtgtgata taatattatt ataaggttga gaaattaacc ttaagggtgc
541 ttaagatttc cttgggatgt agctcagttg gtagagcaga tagctgttaa ttatccggtc
601 gtaggttcga gccctaccat cccagccatt atggcccatt aactcagcgg taagagtact
661 cccctgtcta gggagaagtc tggggttcga atccccaatg ggtcgccaac aactcctcgt
721 agctcagtct ggttagagtg cctgccttgg aagcaggagg tcgtaggttc gaatcctacc
781 ggggtgacat tagagagata ggagcgtgcg tatgtcagac gaaaaggttg tctcgattgg
841 tgccgctcct ctttctgcca aagaaaaact agacctttat tgcgaaggac tagccgatgg
901 attaaacaaa acccaagcct atgtagccgc tgggttctcc cccaatcatg ctcaacgcaa
961 cgttgcagct taccatcgga aacatgccga gtacatcaat gcctttatct cagagcgaat
1021 cgggagtcac gtccctatgg cgctccgtgt gatcgtctct attgcagaag atccaaatga
1081 gaaaggtggt atccgcctca aggcagccca ggatatcctg gaccgaggtg gcttcggtgc
1141 taagcagaaa gtggagctta ccactaagaa tgtggaagat atgtccgcag aggatctgat
1201 gaatgaagtt cgacgaatac tcgacgaaga gccagacttg gctaaagtcc tttctttccc
1261 gaccgcttga cttcctgagt cttattaaga agcgagaggg gttagtactc cagtggtaca
1321 aagactcctt gggatattgg accgggggct acggccacct acagcgtccc ggagaggatg
1381 gacccatcac cctagcccga gcagagactt ggctagagaa tgacagtcag gcagcctacg
1441 atgcagccca acggcaagta tctgagctgc ctttttgcac tccagaacta ttcgatgccc
1501 tagtgagcgt caacttccag cttggtacag catggactaa gaagttcccc aagacgtgga
1561 accttctgaa agccggagag ttcgacagag cagcttggga ggccgaggat agtgcctggg
1621 ctaaacaaac cccagttcgc gtaagggacc tccaacgagc cctttggcga gcatctacga
1681 taggtagcac ggtgacttaa tggataccca agagcggttg cgtaacctag tcagagaatt
1741 ggctgagcgg cagaagtact tccgcatgaa ccagtacacc ccctatgggt ggcaagagaa
1801 gttcattgca gcctcttcta attgtgctca gctactggct atgactggta accgctgtgg
1861 taagacatac accggggcct tcatcatggc ctgtcatctt accggtcgtt accctgagtg
1921 gtggactgga aggaaatttg acaagccagt aaactgctgg gccgcaggga tttccacaga
1981 tactactcgg gacattcttc agtctgaact attaggtgat tggaagaacc ccgaggcatt
2041 tggcactggg atgatcccca aagaggatat cgtaaagact gaacgtaggg aaggcaaacc
2101 cggatgcgtc caagctgtaa tggtaaggca cgtatctggg ggtttgtcct cgctaatctt
2161 caagtcttac gaaatgtccc aagacaaatt catgggtact gctattgacg tcatctggct
2221 tgacgaggag tgccccaagg acatttatac ccagtgtgta acccgaacgg ctactactgg
2281 gggtattgtc tatctaacct ttaccccaga gcatggcctc acggagatcg tgaaggactt
2341 cctccaggat cttaaacctg gtcagttcct gatccatgca agctgggaag atgccccaca
2401 cctcagtcca gaagttaaag agcagctact ctcggtatac tctccagcag aacgcaggat
2461 gagggctgag ggtattccta tgctcggctc tggtgtagtc ttccctattc tggaagagaa
2521 gttcgtatgt gagccttttg atatcccgga tcacttccac aggattattg gtatcgacct
2581 ggggtttgac caccctaacg ctatcgcctg tgtagcctgg gatgcagaga aggacaagta
2641 ttacctgtat gatgaacgaa gtgaatctgg cgaaaccctc ggtatgcacg ctgatgctat
2701 ctacctcaag ggtggtcacc agatccctgt tgtagtcccc cacgatgcgt ttaagcatga
2761 tggagctacc tcaggtcgtc gcttcgtaga cctcctgaag gatgaccaca acctcaacgt
2821 tgtttatgaa cccttcagca accccccagg tcctgacggt aaacacgggg gtaactccgt
2881 agagtttggt gtcaactgga tgcttactcg tatggagaat ggggatctca aggtattcaa
2941 tacttgtact aacttcctca aagaaatgaa gatgtaccac cgtaaagatg gtaagattgt
3001 ggatcgcaat gatgacatga tctcagcaac tcggtatgcc cttctgatgg cttcccgtca
3061 cgctcgtccc ggtgctgtac gaaacagtgg atactacagg agtgataccg caaggttgat
3121 ccctgattgg tttgggagta ttgtctaaat ggctaagcgt cgtaagatca agcctatgga
3181 tgatgaacag gtacttcgtc atctagacca acttgtgaat gacgctctag acttcaactc
3241 ttcggaacta tccaagcagc gttctgaggc cctaaagtat tactttggtg agcccttcgg
3301 taatgaacgc cctggtaagt ccgggattgt atctagggac gtccaagaga ccgtagattg
3361 gattatgcct tctcttatga aggtattcac gtctggtggt caagtagtta aatatgagcc
3421 tgatactgcc gaggatgttg aacaggcaga gcaagagact gagtatgtga actacctctt
3481 catgcgtaag aacgaggggt tcaagataat gttcgactgg ttccaagaca ccctcatgat
3541 gaagactggg gttgttaagg tctatgtgga tgaggttcta aagcccacct tcgaacgatt
3601 ctcaggcctc tctgaggata tggtagcgga cattctgtct gacccagata cctctatcct
3661 ggcccaaagt gtagatgatg atggcaccta cactattaag attcgtaagg ataagaagaa
3721 gagggaaatc aaggtcctgt gtgttaagcc agagaacttc ctggtggata gactggcgac
3781 ctgtatcgat gatgcccgat tcctctgtca ccgtgagaag tacaccgtaa gcgatctccg
3841 gctcctggga gttcctgagg atgttctaga cgagctgcca tatgatgagt atgagttctc
3901 cgatagccag cctgagcgcc tagtccggga taattttgat atgacgggtc aactccagta
3961 taactctggg gatgacgctg aggctaaccg tgaggtatgg gcctctgagt gctacaccct
4021 actggacgta gatggtgatg gtatctctga actccgccgt atcctctatg taggtgatta
4081 cattatcagt aacgagcctt gggattgccg tcccttcgct gacctgaatg cctaccgtat
4141 tgcccataag ttccacggga tgagtgtcta cgataagatc cgtgacattc aagagatccg
4201 ttcggtactc atgcggaaca tcatggataa catctaccgt accaaccaag gtcgttctgt
4261 agtcttggac ggtcaggtta acttggaaga cttgctgacc aatgaggcgg ctggtatcgt
4321 ccgagttaaa tccatgaata gtattacccc tttagagact cctcagttgt ccggggaagt
4381 ctacgggatg cttgaccgcc ttgaggcaga ccggggtaag cgtactggta ttactgatcg
4441 tactcgcgga ctagatcaga acaccctgca ctctaaccaa gcggccatga gtgttaacca
4501 gttgatgact gcggctgagc aacagattga cctgattgcc cggatgtttg cagagactgg
4561 tgttaagcgt ttgttccaac ttctgcatga ccatgccatt aagtatcaga accaggaaga
4621 ggtcttccag ctacgaggca agtgggtttc cgttaaccct gccaactggc gagagaggtc
4681 tgacctgact gttactgtag gtattggtaa catgaacaaa gaccagcaga tgctccacct
4741 gatgcgtatc tgggaaatgg cccaggctgt agttgggggt ggtggtctcg gggtccttgt
4801 ctctgagcag aacctttaca acatccttaa ggaagtcaca gagaatgctg ggtacaaaga
4861 cccggatcgc ttctggacta accctaactc tcccgaggcc ctacaagcca aggcaattcg
4921 agagcagaag gaagcccaac ctaaacctga agatatcaaa gcccaagctg atgcccaacg
4981 tgcccaatcg gacgccttgg ctaagcaagc ggaggcccag atgaagcagg tagaggctca
5041 gatccgactg gctgagatcg aactgaagaa gcaagaagct gtccttcagc agagagaaat
5101 ggctcttaag gaagcggagc tacaacttga gcgtgatcgt ttcacttggg aacgggctcg
5161 taacgaagcg gagtatcatc ttgaggctac tcaggctcgg gctgcttata tcggagacgg
5221 taaagtacct gagactaaga agcctgctaa ggcagtgagg aaataacctt gggagaacgt
5281 tttggctata gtctagtgct gactgatgca gcacagcaga tggtacgtga gaacgttctt
5341 cccgagcttt tccgtattgt ccaagaggag attgagggcg aatggaaggc tacggccccc
5401 aaagatagtg agactcggga ggcgatatac cacgagctcc acgccctcaa ccgcgtacaa
5461 cttcgtatcc aggcaatctt ggattcgatc accctaaagg agtataagta atggaccttg
5521 agaatcaagg catggatgaa ttcgaggcag cggaagcctt tggtgatttg ctcggtgatg
5581 acctcctggc ccccggtgat gaaaccatag atggtaaagt cataggtgag gaagaagagg
5641 aagaggttga aaaggaaacc cccgagggtg aatctgagga tgagcctgag gaagagcctg
5701 aggaagagcc tgaggaagat cctgaaggtg aatccgaaga ggaacctgag gaaggttctg
5761 aggatgacct ctcggataag ctctttgaga ttccgatcgg ggatgacatc tatgaagtca
5821 accttgaaga actcaagagt ggttaccttc gcaatgaaga gtttgtaacc cgtcaggctg
5881 agctggagga agagtatgcg gctaagcttg aatcagttga tgctgaacgt gctaatctat
5941 tggccgagct tgagcagtat actgttaccg ctatcgctgg tgctaatcag tatgatagca
6001 taaactggga gcagcttaaa gctcaagatc cggagaagta tcagaagctt cgcctagagg
6061 ctcttgaggc tcgggagcaa gcccaggcac ttattaaacg tcgtaacgat attaaggcta
6121 tgcaagagaa gcgagccgag ataatccata gttcctacat caaacgtcag acagaattgg
6181 ctaagaagct aatccctgag atgactactg atgagacttg gggcgataag atcgtagctt
6241 acggcaaatc aattggctac tccgaggatg aaatccgggg tattgctgat gcccgccaac
6301 tggctgtact tgatgcagca cgtaagtggg ctgagtctca ggtccgtcgc aaggctgccc
6361 tagagaagaa ggaggagact gaactacctg ctgctgttaa gcctgtagct cgtagggcgg
6421 aagcctcaga gggttctaag cgggttaaag ctgcccgtgc taatctgagg aaagatcagt
6481 cggttgaagc cgctgctgct ctcttctcct ctctcgacat tttctaatag aaggaagtac
6541 attatatggc aactccaact aatgccgtct ccactgtaga gatcaacggt aagcgcgaag
6601 accttatcga tatcatctac aacatcgctc cctatgacac cccattcatg tcggctatcg
6661 gtaaaggcgt agcaaccgct atcacccacg agtggcagac tgacgagctc cgtcagccgg
6721 gtaagaacac ccgagttgag ggtgaggatg caaccatcaa ggctggtagc ttcaccacca
6781 tgctgaacaa ctactgccaa atctctgacg agactctgca agtcaccggt actgcggata
6841 aagtcaagaa ggctggccgt aagaacgaac tggcttacca attggctaag aagtccaaag
6901 agttgaagct ggacatggaa tacgccctgg ttggtgcccc tcaggctaag atccagcgta
6961 acaccactac tccgggtcag atggctaaca tcttcgccta ctacaagacc aacggctccc
7021 tgggtgccaa cggtgttgcc cctgtaggtg acggctcgga taccggtact gctggtgatc
7081 tgcgactgct gaccgaagat atgctcctga acacctcgga gtcgatctgg cgtaacggtg
7141 gtcaggctaa ctcgatccag acttctagct cgatcaagaa ggccatcagc aagaacatga
7201 agggccgtgc tactgagatc accctggacg cttcggataa ccgcatcgcg cagaccgtag
7261 acgtctacga gagtgacttc ggtaagtaca ccattcgtgc taaccgttgg ttccacgaga
7321 acaccctgtt cgtcttcgat ccgaagatgc acagcctctg ctacctgcgt ccgttcttcc
7381 agcatgaact ggctaaaacc ggtgacagcg agaagcgcca actcttggtt gaatacacct
7441 tccgtgtaaa caacgagaag tccggtgctc tgatccgaga cgtcgtagcc cagctgtaat
7501 ctagaggggc ccttcggggc cccaagtttt cctataggag atcatcatga gtatccaatc
7561 gacttatgca attgacgaag accttgggct ctttatccga aaggatactc aagatgttga
7621 gtcaatcctg tccgctaacg ccgaagagcg tcattcgggt gtaaacacta accgtaagga
7681 taacctccgt aaggttgcta gtatcccgct ggttgttgta gaggcactac ggaatcgtcc
7741 aatgtctgag ggtggcccca tcgatcttaa cctgattggt tgcgaccctg accatgccgc
7801 tcgatttacc cgttggctta acgaccgaga taactatcgt atgcggacct ctgaggcacg
7861 ggtataataa tggctacgat taataacgta actgatctcg ctattgccgc aatccagtgg
7921 tctgaccgtc aggaccttac ccaagaactt ctgatgttgt tcattggcaa cactactgac
7981 cgtctcaacc gcctcctgcg ggtacgtgag aacgaacatt ttgaaaccct gatggccttt
8041 ggtggaggca tcgagatccc tgagcacttt gttgcccttc gatctatcac aggggatgcc
8101 ttgatcggtg gacgtactct ccagtacatc acccaggatg tcttctccca ctatgttaat
8161 tacaactacc aaccccaagg tgtgacttac tacactcgat tggggaactt ctggcgagta
8221 taccctgttg ttcctgacgg tgccccgttc attgtgaact actggactgt tctcccagag
8281 ctgagcttgg ctaacccaac aacttgggcc ctgactaagt acccgcagat ttacctctat
8341 ggtgtccttg agcagattta tctgtacacc atggatgaag agcggtcgat gttctgggga
8401 cagaaactgg aacgggcagt catggaactc cagaatgaag agaatgccgc tgacttcgct
8461 agcactcgac tggcgatcaa ggatatcgaa cgttaaggag catccaatgc ctatctttct
8521 caaaaccctc gcaatcaacc tcctggctac cctctttcca accaaggtaa tcgctaagtc
8581 catcgtgact ggtgctaaag ccctggctga gaagactaac tccaaggttg atgacgagtt
8641 tgttaaagtc ctggaggaca atctaaagga gaattcggag gatgcaatta ctaactgata
8701 acttgggcag catcgtcagt gccctggtag tttcctcggt agtgacggta ggttcctcgg
8761 ttgtcggtca gagtgtgcat caggctctgc ttgaacgcaa catccaggcc acggagaagc
8821 tcacccaagc ggtgagcgaa ctccagattt ctatggcaat ctttggggag cggtatgtca
8881 cccgtaaaga aatgaaagaa gaattaaagg aggccaagaa tgggtcttga ggtcgcaacg
8941 tatatcgatc agttggtgcc tacgaaccct accggctctg atctgaagtc ctttggggat
9001 gaccatattc gactcattaa gagcgccatt aagaatacct tccccaatat taaccaagct
9061 gtcactgtaa cggcatccca actgaacgcg gtcgcagaca ccacccagta tgttaaacct
9121 gggatggtta tcatgtgggc gggtactctt gctcagatcc cagcaggttg gaaactctgt
9181 aatggtgtag ggactacctc taacggtatc cccgtaccta accttatcgg ggcattccct
9241 tggggtatcg atggtacatc ccaagccgta ggcactcggg gtggtaacgc taatatcgta
9301 tgggatggac tcaccgaggg tcacgctctt acgctagccc agatcccagc acacactcac
9361 acttggcgta cccgaggggc taccaccctt actggttctg ctggtgattc tggtgcgttg
9421 actggtggtt ctggtaacgc tgccaatacc aacctagaga ctggccctgc tggtcaaggg
9481 caggcacaca cccacactgt taagatcaac atgcccctgg gcaacatccc gccgttctgt
9541 gctgtattct tcattattaa gaactgaggt ataaaatggc cctagagaga caagaggtca
9601 agaacccaac gggtatcgtg actgatattg cacccgctga cctgcccctg gataaatggt
9661 ccttcgggaa caacgtccgg tttaagaacg gtaaggctca taaggctctg ggccattccc
9721 ccatctttga tactgcccag gcacctatct tggatatgtt ccccttcatt cggaacaaca
9781 tcccatactg gctcctgtgc tcagaaaaaa ggctttactt ggcagatggg actaccatca
9841 tcgatgtgtc cccaggtcaa tactctgcga gtgtaaccaa ccggtggtct gtaggttcct
9901 tcaatggagt tatctttgct aacgatgggg ttaaccctcc ccaccaccta ccaccaactg
9961 agagtgtgtt tagggttcta cctaacttcc cagcgaatac aacctttaga cgtcttaagt
10021 ccttcaagaa cttcttggtt ggcttgaatg taacgtctaa ctctattgaa atgccccaga
10081 tggtctggtg gagtacctcg gctgatgctg gtggtgtacc ggcctcttgg gacccaacag
10141 accctaccaa agatgctgga cagaacacct tggctgatac caatggtgct atcgtggatg
10201 gtgtgaagct tcgtgactcc ttcatcatct acaaggaaga ctctgtatac tccatgcgat
10261 atatcggtgg tctttacatc ttccaattcc agcaactatt taatgacgta ggtatccttg
10321 gtcctaactg cgctatagag tttgatggta accactttgt tgtaggtcat ggtgacgtct
10381 atgtccacaa cggtgtacag aagcagtccg tgattgatgc tcaggtccgt aagttcttct
10441 tctcggatat caacccggat aactaccaac ggacctttgt gctagctgac catgtgaata
10501 ctgaaatgtg ggtatgctac tcctcgactc gatctgagcc tgggaagcat tgcgataggg
10561 ctatcatctg gaactggaag gagaacactt ggagtatccg agacctccct aacgttctca
10621 gtggagccta tggcatcatt gaccctaaga cttctaacct ctgggatgac gactccaacc
10681 cctgggatac cgatacgtcg gtctggggtg aaggttcata taacccagcg aagtctagta
10741 tgatcttcac gtccttccag gatgctaaac tcttcctctt cggggagact tctacgttct
10801 ctggacaatc attcacgagt acccttgaga gatccgatat ctaccttggg gatgaccgaa
10861 tgatgaagac cgtcagtgct gttatacctc acattacagg caatggagta tgtaatattt
10921 gggtaggtag tgcccaggta caaggctcag gtatccgatg gaaagggcct tacccgtacc
10981 gtattgggca ggactataag attgacacca agcatgtggg ccgatacatt gccttgaagt
11041 ttgacttcgc ctcagcaggt gactggtact tcaatggata tactttggaa atggccccga
11101 aggcaggtat gcgatgagtc aaaggtacag cccctcgatt ccgccacagg aagaggagga
11161 actgctgccc ttccttaatg aggaattcgt tagggttgga cagactctca atgatgtggc
11221 tgatggctat tggggggtct ctatggagcc ccctaagaag cttaagccag gaacggttaa
11281 gtattttgcc cctggggtag taggtcctgt atcaggtatc tattattatg acttggataa
11341 ccagtggaaa ctcgccggta ctaaacccaa ggatctccca ggggatttta tcctattcac
11401 ccctgctaat aatcatcagg ctatgggcac ctgtgcatac cggatgaata cagacaagga
11461 tgaagtgtgg attacccttc tggcatccgg agggaattat actgacggtg ctacagtgtt
11521 ggaccttccc caagcctatt ggcctcctgc ggaactgttc atcccagcat tttccagtat
11581 cattccagcc caaagccaga tcacttatcc accaccctca gaccccaatg caccccctct
11641 ggatcaagtc tttgatgttc ttaatcgggc tacaatccaa actgctgtgg tcaaccaagc
11701 aatgtttaag cttacggcta atggtcgtct gcttatccaa ggaattcccc aaggtgctat
11761 cttcgggggt acgtttactt atcccctagt ggtgactcca tgattcattt gattactcgt
11821 gagaatattg actcccttcc tactgtagcc cctgcactag ctcgggcatt caataggact
11881 gacttgggta agttctggga ctttgagcac ctggtacact ccttggttaa ttacgaggcc
11941 tttgtcttct accaagagga gagtgggtat gctggggtgt tgcaagtatc ccaagcccct
12001 ttgggcaaca tcctacactt cttctggagt ggtaagatgc ctgggaatga aactccgata
12061 gactaccccg aggttgatga gtacctggga cagtttgccc agaagatggg ctgtcggttt
12121 atccaatgtg aaggtcgtcg gggctggaag cctacccttg agaagcttgg gtacaccgag
12181 gactccgtaa ccttctatag agaggtaact ccagatgaac ttcctccaat ttaatgttaa
12241 acggctgatg gggttcaacg tagaggatgc ccttgatagt cgggcttata aggggggtag
12301 taagaagcaa accactacct ccacctctac cccatatcag cagggcaatt acaatgaact
12361 actctcgggt gccagttctt ggctacataa tgggggcttt gacccgaact acggtggtga
12421 tccgaacttt gatccagtgg ctgaccaaaa tgctctccaa ttgggtggca tcgaggggtt
12481 gggtaatctc gggggagccc tccagtctct cctgggtagc tcaggtgtta gctctctggc
12541 tgattacctt ggtccttacg atcccaataa aactggcttg gcgaacgcca ttggtgcagc
12601 caacgagcag atgcaatggg acttcgacac tacggtacgc ccagacctgc gtgcaggagc
12661 gaccaatgct ggccagtatg gcagttcccg agcgggtgta gccgagggta ttgctaccgc
12721 taggctgctc cagaatcaac agaataacgc ctctcagttg gccttccaag accagcagtc
12781 ttacaaccag aaccgtctga acaccctggg taatctctcg gctatcgcta agggtttggg
12841 ctctggtaac gccatgcagg ttgatgctgg atctatgctc cagggtcaag agcaacagga
12901 aatcaatggt gctctccaga agtgggcata tgagaacaac gttagtctta acgacctcct
12961 cgcctacaag gaactgatct ctggtgacat gggtggcact aatgtatccg tcaccaaagg
13021 ctctgggggt ggtggtggtg gtctcggttc tgccctgggt gccctaggtg gtgcctccct
13081 gggagcactc ttcggaggcc cagcaggagc ttctgtgggt atgaacgcag gtggtcgagt
13141 tggaggtctg ttgttctaat ggcctcttta actcagaagc tgttcaccat tggacagaac
13201 atcggtggtg gacaggagcg ggtacagttg agtcgtcaag gctcctaccg ccctgtccac
13261 ctggggtcgg gacttagtga ggaatctagt agtggacaat caaacccttt tggcgcaatg
13321 ggcggagcag cactcgcggc tctcctcggg aaaggaagtg actctactcc agaaacagta
13381 ccaagctttt ctgtcgaagg ggctagggga gcaagcgaac aaggcgcagc aaatgttgca
13441 gcaggtatgg gagcgggaat gggcattctt cctagcgcag aagacctcgg ctttggacaa
13501 ctcccaaagt caggaatcct aagtaaactc tttggaggtt aatcctatgg ccagcatggc
13561 ttatgaaggg tccccaattc gccctagcat ccttcgggct gctcagaatg aactggatat
13621 ggcgcgaatc gcaaggaaca aactgccgct ggctgtagag ggctcaggta ttcctgatcg
13681 tgtccgtcgt gctgctcagg cagccctgga gaacccagag cgttggtccc gtgcagccca
13741 agaggttgca cctgcggctg aagctactgg tcgtggtgcc cttggtcgta tcgcaggtat
13801 ccttggtggt cctgtaggtg taggcgttca ggctgctgta acccctgccg acattggtga
13861 ccaagagcgt actcgtgctg aggaaatggc tcaagctgct caggcagtag agaacatggg
13921 tcctgaggtt gcccagagtg ctaatcaatg ggcccagggt gtaggccaga gggcagctca
13981 gaatgccaca ggaggccccc aaggagccgg cctgttgtct tatggtgtta cccctaacca
14041 accctctatc gagcctgaga tcaccccaga ggtggcttcc gaggctggtg ctgctgtagc
14101 agatgagggg gaggctaatc gccaggtcat ccaacagggt gcagccgagg gtcttcgtac
14161 tggtgctgta agtcgtcctg aaatggccca agctgtagtt gaggctgatg cccagcgaga
14221 aggtgtagag cttaaacccc aagagcttaa gaaccgggtg aacgaagagt tgacccagat
14281 gaggactatg gataatgatg acctgtctcg ttatgtatct tacgctctca ttggtactgg
14341 tcttctggct tcggccctag acaagactgg taaagccggg gatatgttcg ctgcttccta
14401 tgagcgtcaa ttggatcgta acctacaggc tggtatcaac caacagaaga tggctgctgc
14461 tgctgctgat cgtcagatca aggagaagga tctggaacgc aaggttgcta aggataagtc
14521 tgatgagcgt ctggggattg gtaacctaga ggttaagcgg ggtactctgg aagaaacctc
14581 tcggaagaat gagggtcttc tgtctaaatg ggaaaaacag gctgctgtag aacgggccaa
14641 gcttgcccta acccagcgtg gtcaagacct agctacccaa cgggctcagc tccaggctga
14701 aaccgctaga cgtggccagg atatgtctca agagaatgct cagctaaatt ctgcggtacg
14761 tctcaagact gccaagatca gtgctgctgc acgtaaggct gccgcttcgg cttcccgtgg
14821 tgaggctatc actaccaaag atgccaacga gttggtcaag ggtgtctctg gttcggatct
14881 ggtaggtggt gctaagattg gtgaacaaga ccagtcggct atctcccaga agcttcggaa
14941 ccatctgagg cagaatcctg gggctgaccc agttaccttc gtacagcagg aagcggccaa
15001 gctacagaag caaccgtcgg gtctttttgg ctggggatcg ggtattttga gtcgtcctgc
15061 ccctaagtga taaaaggtac ttgacaaggt attaaaactg tggtataata gatctatagg
15121 cacttaagat tatcttaata acttattgta ttattaatta aatctttagg ttatcttaag
15181 atagtcttaa ggtgcttatt ttctattcca gcaaaaaggt gacttatggc tctttcccct
15241 gaaatgaaag ccgctattgc tgcggaactg gctgaggtaa aagacctcga tgtagccgct
15301 gagttggctt cgttgaatga gccagaagaa gtagaggtag ctccacagga agtaaccccg
15361 gaggttgtac ctgaagctgc cccagacctg agcgctttgg ctgctccggc tgatcctaat
15421 tctattggtt ctgcgatcaa tcgtgggatc gataccatgc agtctaacat cggtggcact
15481 attgctactg ttggtgagct gactggtagt gactacctca aagattacgg cactcagatg
15541 gctgaggaga atgcccagga ggcgtcacag tacggaaccc cagatgttcg gtcttttgcc
15601 gatatccaag atattccctc cattggttct ttcctaaaga ataatatctc agaagccctc
15661 ccctcaatgg gagccgtaat ggctggtggt gccgcaggtg ctaaggttgg atccatgttt
15721 ggtgcccctg gtcgtatggg tggtgccctc ataggttctt tcctgagctc catggggatc
15781 aacgtgggtg ctctgaacaa ccagatgaag gagcttgacc ccgagggtag taacccctgg
15841 actgctgtcc taggtggtgc tggcctctcg gtactagata ctgcgggtgc tggtgttatc
15901 gctgccccac tcctcaaaca catcggtaaa gatggcgctt accaaatgtt ggtccaatcg
15961 ggcctaccta agcagactgc cattgaggct gttactcagg ctggtaagca tgcggctgtc
16021 tctggtgtgg ctgagggtgt tacctctggt gcccaacagg ccctacagga caccattgct
16081 tatgatgcag taggacaagt acaacgtcca gaagagttca tggataacct actgacggct
16141 gcattcgctg gatctgccat gggtgtaggt gggggtgctg tatcctctgg tcttaacact
16201 atggccagca acaaggattc agcaggctca gcccataccg atcctaacgc cccttcggct
16261 gctcctacgg cttccgaaat ggagcctagg ggtactatca ggaaggcctg ggatgccatg
16321 ggtaatgaag ctacggccct cctggagcca cttgctaagg cctccccgat agcccgtgag
16381 ttctctgaga cctttagggc tgacatgagt ggtgagaggg cttctggtaa gaccatcttc
16441 gaggatcagg aactccaggc tggtaagtgg aacactaccc tggataacat catcgaaggc
16501 aagtccaata aggagatccg ccagatcatc aatgatgcct ctatgggcgt caatactcct
16561 gaggctaccg ccctccgaga tatcttgaat gatgttaggg ctgaggctag tggtcgaggt
16621 ggtatgtccg ttgggaatat cgtcaactat atgccctttg gactgtcccg taagaaggta
16681 gaatcccctg agttcctaga tgatattact ccttatttcc aagaccgtca ggctgctgag
16741 gacgctgtag ctaattggct ggcagagact tcggatgata cccgaggtaa tactgcccca
16801 gaagttaccc gcctagtcac tcagaatcag actacaggtg cttgggaggt agatccacgg
16861 tatcgtatcc agggagatcc tgataccctt cggggacggt ttgcccagag tgatgcagta
16921 cctaagtatg gtcaactgga ggaaagtcgt tcctttggat ctgtacctca ggagatcctt
16981 aataaataca ccctcaatga atcccctaaa gacctcatcc aagagatccg ggattacttc
17041 gagggatctt cccaccggat tgcctttacc gagcggtttg gtatcaacgg ggagaaggcc
17101 aatgctatga ttgcttcggc agtagcagag gctcaacaaa atggtaagcg agtaactaag
17161 gaagaagtag accggatgta tgacctagtg gatgcctata acggtatgca cggtcgtata
17221 aaagatccga atatcaagaa gctggctgct gtagtgtctg gtggattggt cttgtctcgt
17281 cttcctttgg ctggtctctc taccctgacc gagttcagta tcccatttgc taaggctggt
17341 cccatgactg ccctgggtgc tgttcttcca acagtgggtg aagttgcccg tcaggctact
17401 cgtagtgtat tcagcagcat tcctaaatct gagactggga gactcatgag tgatatgaac
17461 cacacactgg cctctgctac ctctttgatg gcagatcggg ttggtgctga ggtattcaac
17521 cagtacactc agaaggctgt acgtgggatg ttcttggtca acggtctgtc catcctgacc
17581 catgttgacc gagtattcgc cacagagaca gccaaaaggg tctatcagaa caacctcatg
17641 gacctcgccg ctgggcttcc ctttagctca gctaatggtg cccttaaggt tgctcaactt
17701 agggaaatgg gtgtgaacgt gagtagccaa gcggatgccc tcagattggt atccccagca
17761 accccttcgg aggttctgat ggccaacaac gttaagaccc tagctatccg taggttcgta
17821 gaccagacgg tccttgaccc aactttcgct gacaagccta tgtggatgag taatggtaac
17881 gtccagatgt tcggacttct gaagggttat ccagcagctt atggtaacat tatcctcccg
17941 atgatgcgcc gtaggttgtc ccctcacttc actggttctt ggaccaatgc tgggatgggg
18001 gctgcgggtg tagccttcac gcttggtctg atgatgagcc tgggttacat ccaggatgaa
18061 ctccgtcaga tggctaagtt tggtggctct agtcgtgagg atacccgatc agaagagcaa
18121 aggattatgg atgtattgat gcaacagatg ccactccagg cctctatgat ctacgatatg
18181 ctaacagctt accggagagg taccaccccg gcagaggtac tcctgggccc tgtcgcaggt
18241 gcagctaccg aaggagctct ggctgctggt aagactattg catccttcaa tgatgatcct
18301 tccgctggtg agatttggaa gttcttgtat aagcaaactc cggcccgtcc tttcgttgca
18361 ggtatggaag caatggaaga cgctctggat ctataaggag aagtatatgg caacttacgt
18421 tgaaactgaa gcagccggcc caggtggccg agcctacgtc gtggacgtac cccaggtatt
18481 ccgtcgtaac aaggatgggg atctcattga gattactgct gacgctggac gagtgaatac
18541 caacattgta actgctacag agttcctccc ggactattac gcggttaaag agaacgcagc
18601 cctggttgta gagaacgtaa ctgcctctta ccccgaccat ccctcggaag cggtagtccc
18661 cagcgtcctc gtgaacaccc tcatcggtgc ccctggtgag acttctggtg gtaacgtaga
18721 cccaggtcac gtcatcggtt tgttctctga gactatggtt gaggcccctt gcggtactgc
18781 cttcggtagt gagttccggg tagacccccg tcgggaacac cttggcgttt acgtggctat
18841 caagcacgtg attggtccag atgaccaaaa tggtggtacc atcggtgact acattatcga
18901 gcagtttgac gacatgcgag gccctgttca gaacattggt tctctccagc agaactatct
18961 tgacccacgc cttgtgacta ctcacctggg tggtaacgta gtcaatactg cacaactgaa
19021 tggtaatatc acacttaccc gacagaactc tggtcagcac ttcatgagta tgtcagctac
19081 ggatatcacc gtgactttgg gccccgatgt aaccccaggt tgtgtattcc actttgtgca
19141 aggggctgct ggtaagatca agttcgctgt ctccccagac aaggcttggt atgccaaggg
19201 caaccagact gaaactgatg ctcagttcgg tgaatgcacc gtccgggtat accccttcgg
19261 agggactgtt ggttctttca agagtggtct ctaatggacc caatgtctat tcttattcgg
19321 gaagtgaggt aatctaatgg caacttatat tgaagatgca aacggtgaaa gcgtattcgt
19381 gattcagtcc aaggctattg ccgttcggaa tgaagacggt actcttcgtc atgtgatcgg
19441 tcccaaagac cttaaacctg ttcaatggga cgaggtggag gggaagcctg agcttctgga
19501 ggtgggatcc aaggctaacg aggctaagcc tgggaattgg aaacctaagg cttccgaagt
19561 tgtaggtctg gatgcagtag ttaaagctgc tatcgaagac cgtatcaagg atatccccgt
19621 agcatcctat caggatagcc acgaggccct tgtggataag tttaacaccc ttctgaacgc
19681 ccttcggggc taacctaaag gccccttggg atttaccctt ggggcctttt tttggttagg
19741 ttcagacttc tacggggtga tacttgacta cactctcatt cttggtatca gcgaagtccc
19801 gaatgaagca catggcgtcc tgtagggttt cgaagattac cgggagggtt atgtcactga
19861 gggaggggcg gaaggggtcc ttatgttcac tctcaaagtt tctccaaagg aacgcctttt
19921 tatactgagg gaagaagtac tttccaactt gctttacacg atatttcata aacttcccac
19981 ccatgacaat atctcgaaga atagacttaa gagttctccc atcgtcagga gtaacatcag
20041 tcaactgtat cccacataga ccagaatagc aaacaggatc gatacgaata tgtatgtcca
20101 cgggaaaccg cctttaacct tttgatcgtt cttcatagcc cctccaatct ccatagaata
20161 cagaggatcg ttggtccacc agatccagca tagcctccag catttccaac cgctctttag
20221 cctccagagc tgccttcttg aaggtcgcta gctttgcctc agacttagcc agttgaccct
20281 ccatttctgt cagaagatcc tctagttcag ctttcgtcat agtacaccac cttgtcgcta
20341 gtcctgagta catactcaga gtcaatggtc caactcatgg ttgggcattt gatccggatc
20401 atcttggggg taaacccatc gactacccca atggctagat gggaggaagt attccggtga
20461 accagaaaca ccaccttgtc ccccacctca agctctcgtc ctactcgatc tctcatggtt
20521 accccttgat atccggcagg tggatgctag ggatgtatag gatttctagg acctcaatag
20581 agtacatacc tcgggcctta ccctcagcag caccccctct cccgaacttc atatccagcc
20641 acaactcggc ggagagaggc gtcttaaacg ccaatccccg ttgaccgaag tcatggtccg
20701 acttgatgta gtaaatgtca ggtaggaact tactcacagg aactcaccta cagacattag
20761 cttgaggtca tactcaccac ccttgtgatt acgcaggagg gctacacctc gccagtgatc
20821 gttaccctgg gggcccttgt aggactcgtc atgggtgtag aagctaccaa ctaccaaccc
20881 atggatacgc tcctttccta ctgcctcgat gtggtacttg aacccctgtt cgtgtccttg
20941 gacaaagctc cgcttgatct tattgaggcg atgctcggcg gaaccaccgt aaggccgacc
21001 ggagttgggg ttatagaagt agtgggagaa ggcaacacct tcgatgacac ccacgtcgag
21061 gaaatcatgg acaatccaat cggacagatc aaaatgatcg tacccaataa aaccttggag
21121 agcagggtta gagttctcat accgcttgat acgctcctcg tggttaccga tgaagaagtg
21181 catttctggt cggtagaccc gcttcttaca actcgcttgg tgactctgta ggcggcgaag
21241 aggattgagc agtagtcgca tcgcatcatt acccgcttgg atatcgctga ggactcgacg
21301 tccctcgatc tttgcggtac cacggtcgta gcttgacagg ctgggcatgt cccaatggtc
21361 cccaatatgc acaattcgct tgggacggtt acgtgcgatc cattccccga gattcccgag
21421 gtggtcaacg ttgacccctg ggcggacttg ggtatccgca atgacgaggg tatcttcatt
21481 atagcgctta ctcattatgg aaggactcct tgaaagtctc tagagtgaac cagcggaagc
21541 catttcgttc ggcccactcc gccatagttt gctttgtacc atccttgcgc ttcttaagcc
21601 aatggcacgc tgtatcgggc ttctcgaaga tgaacacaag ttctgtatct ggggggagac
21661 tttccctcac ccatacatac tttgcagcct cagacgcctc ttggaagtac cccttgacct
21721 cgaccaacaa aatcttcgtc gatgatccag tctctaaaga tgccctgaag tcggggtagt
21781 acttgtgctt caccacgtaa gtgagtggtt gcggcttgaa ctccatcgat ggcatcgtct
21841 cgtgaacgat cttctcggtg ttggagtcgt agggcgtccc aatcaatgac ttcagcttgg
21901 gccggaagaa tctcccctgg acgctcaatg atgttctcct cttgaagtct cccgataacc
21961 ttcagggcac tctgctgaat gttgctacca gccaagttga cccagtgaag gaggttatcc
22021 gagagtttta ctttatggtc agggtatttc tccatgaccc tacggatgtg gttcacaaga
22081 cgatctactg ctccatccga gataatattc tcgtgaacag tgtggccaag caaggggtca
22141 gcgatgttaa tgagggtaag ccacttatta cccttgtccc tggtgtagtc aggaccgtag
22201 agtaaactat ggtcaccatt ccagaagctg atactgcaca ggccaatgtc gaatacacat
22261 gggtgctcct gattacacac gatgagatta accggaaggt gtccctcggg gaattcacaa
22321 gactcccaaa ccttaaacga attggggtaa tcgttattaa cctctttatc ccctaaccgt
22381 actttcttat gaccaatggc gttgaagaag cggatgacgt taacttcaat ggtatcctca
22441 tctactgcca taggaactac acggacgcga ttacggatag cgacctcttg gagggtacgg
22501 ggctctacaa cgtagatatc aatgtccttc ggcacaaccc cgttgtcaca atcccggagg
22561 aatccacccc caacccgaag gccagtgaat ttggtggttt cctctaggat cttgaagagt
22621 tcccgacata ctctaagggc ctcttcaata gaatagttct ccatcttcat aaggtatctc
22681 ccaatgtctt attactcggc aattaagctc gttaccggac tgttcaatat caaaccaatt
22741 acggtctctg atgaggtaga ggagacgaaa gttctcagta agatactcct tccaattatc
22801 tccatagact ttttggtact cgtaggcgca agcctggaag agatccttct cagtagtaag
22861 gtgcccaagc aaatctgccg ctgacttagg cccgatttca ggacaacctg gtatgttatc
22921 cacagagtca ccaacaagga gttgtccata gaggaatgcc gtaccgtagc cctcaagctt
22981 ccaggacttt tggggcttct tcttcccata gagtctccaa gaagcggaca ctcgtccaag
23041 gccctcgtta cgaaagggtc ccaattctgg ctgcttatcg ccacaggccc aactgtaatg
23101 gtggcactcg gtgatttggc ggatatcctt gtcgcgagaa catgccgtaa agttatcccc
23161 ctcctcagtt ccccgaaccc cgatccaatc atcagcctcg ataccgttga cagtgactgc
23221 tccccactta cctttaagtc ggtctgacac tgtttgccag tgatgtggct ttgtatttcc
23281 gacgcgagtc cccttatatt ggcggatcgt cgcaagctcc aatcggaaat tatcttttcc
23341 agtgaggtat acttcgtagt catcagcccc tactctctct atgatttgtt ctatcttttt
23401 atctacaagc tcgtggactt cttcctcggg ccatggccta actacctcaa tgtcgaagat
23461 gtgttccttc ttcatagcga tatggcctag ctcgtatcga agtacgtcac catcaatccc
23521 cgcgatcatc cttagagccc tccggacctt tcttaagaat ctcttcccag tgcttggtga
23581 gggcaaatgc ttcgcccttg gaccgatact cgggatgctc taccacaggg ttggctagag
23641 cttcgtagcc cttccaatca taatactcac tttcttgacg acgggcttta tccatagcat
23701 cctccgtcag gctgtagcct ggggtttccc ccaggtctac ctcaaggcct ttgacagagt
23761 agttgctggg aactgtctta gccctcggat ccagcagaag ttccattaga actctcctct
23821 tgttggatta ccagctctag ggctgctagg gcgttccaaa cttcgtgata ccggtggggt
23881 agaccacttt gggggtccag tacctcaccc ttgtgtcgtt caaggaggtg tcgtccgaag
23941 gcagcatcat atcgctggat tccgttctcg acgaacctcc aacccccgcg actatatttg
24001 cttgctccga agttagcaac ttgtgccacc gcatatagag ctctcgggaa agcttcgaag
24061 atgatcccaa catccacctt gcccttatcg agcttagccc ccggatctcc tgccttgatt
24121 ccattgggat ccacctctac cttatcatta gatgcagcta cagaacttac cactcgtaca
24181 ccccaaattc tctcatagtc agctaagcag taggggcagc ccaaagggca tacccccgcc
24241 tcatgatcct ctaggctctt agataggagc atcttcgtca tcgaagtcct caccaaatac
24301 gtcctcaggc ttgtcctctt cctcggtgaa accaccaccg aacagcggat catcctctcc
24361 atcaccacca gatacaatct cgtggagacg tacaccacgg agacggaggg cagtgatggt
24421 acctttaccc cgagcaccct tctgggtttc gatcaggata ccaacttcac cagtagagcc
24481 accccacggg ttggggccat catacggctt gttgtcgctg gtcaggacaa tcggcttcat
24541 aacagcggac ttacgctcac catcctgcat ccagtcaacg tgcttcttct gcttgacttt
24601 gaacaggaac tcaccgtcac gctcggtgta cttgatggta cccttcagac gggcatcctt
24661 ggattccatc ttggctacca actcatcggc ctgttcctta gtcggaatgc agatggtaac
24721 ttggtaaacc tcaccgtatt cagtatccgg ggttacgatg taggggaaga tcagcttcgc
24781 taccggaaag gtgaatcgtt gggatacttt cttagacatt aaatatacct cttgtaggga
24841 agaagatatt atagcacaaa aggggtttta agtcaacccc cagatgtatc agtgtgtgtc
24901 ataccatgat ctacctgcga tagaatcact ggcaagagga cagttacaac ccaagatttc
24961 cccagcttcc ttgacacaag tctccatgaa tccacggaga gtcgcaaggt cctcgggatg
25021 gcactcccac tggccttcat cgtggatatc caaaaccttc cacgccttga gtccagcccg
25081 tcgtaccttc tcatctagga tcaccattgc ccacttcatg acaatagcac cagcagcttg
25141 gaggagggtg ttcaatgcct tgtggaccat cacctctcca gactcactac ggcgcatcgt
25201 tagcttacgt ccgtcgagtc ctacaaggta gcccctttcg gcttcctgct taaccctctc
25261 aatcagctta gccagctctg ggttggcctt aaggaattgc tccctcagcc tagccccatc
25321 ggccctcgtg ccaccaatga tctgcccaat tttggcatcc ccagcaccgt agatgaaggc
25381 gtagatgaac gtcttagcat cgtctcgggt aggtagtcct gcggctattt ggttggcagt
25441 atggacgtca ccatctacaa cctctcgggt atagtctggg tcgccaatgt aggaggcaag
25501 catccgaagc tctagaccag caccgtcata gcccacgaag atcagttgat tcgctgggac
25561 gtatactcgg tatttgccta cagtcttcca cttaccaccc ttgaggacct ccacgatgtt
25621 agtgtggggc cttacccttt cgttctcacc tatgtcgcgg cggaggacag tccatttcca
25681 ttcaccagca ttaggagtcc cctggaacaa ccctcggatt tcaggcccga ggggagaacg
25741 agcagcgggg atattaacta ctacacggtg tctcatacgg cccgtgggtg ttgcacaggg
25801 gttagcactc ccctctaggc gtccattagg cttcacctgc tcgactaatc cctgaaggag
25861 ggagcgtctg tgagcccaaa ccattcgctg catcacaagc ttaccgagat ccccctggat
25921 ggtattcatg gaggtctcag tcatcttcgg agtagtgaga accttacgtt gcttctcaag
25981 cttcctcttg acctcaccaa tggttgtctt ccctgggata atgccttgca gcttcatcct
26041 cagtggccca gagggtgagt tccggaggtc ttcaatgtag cggttcaagg caccattcag
26101 atcagatcca cgtagcttct tgccatcagt gccgactgta atgtccttga tattccactg
26161 gtcaggtacc cacccctgag acagcatcca gtctttgaac cttgcggttt tacccaggtc
26221 aaagtccttg tactcgattg ctgtaaaggg tccagatacc tcgaagtgac ccaagcgttg
26281 ccatagagcg accaagcgtt tgttcggtag accacttttt aggaatggct tactgaatgc
26341 tcccgcttgg acgatcatgg gaggcatctg ggggactgcc tctaggtcaa tcttgaggat
26401 tcgttcgttg agtacgtgga taagccactt agcccgttga gtctggaagt agaccccccg
26461 tttactctgg cggctaatga tatcagctac cttatgctca acgaacagtg actttctcca
26521 atccacttat acccccttaa aacgctccgc cagattctcc actactactt ctacagcatc
26581 ctcggagata ccctccaggt aggagaggta atccacagtc ccgcttcggt ccagtctcca
26641 ttgctgctcc aggaaggcta cggcaacctg ctttagaagg tagtcgtcga tacgctccat
26701 cagcacactt ttcactttac tcatgtcatc accaatcatg gacgaaggtg gatacgcccc
26761 tgcaaatagc aaggtccaca aggaagttgg ccaggtcaac cctacgttgc tctttacgga
26821 tacgctcctc actaccgttg ttcttcaggt agtagtggag gttgaaaagg gagtcccgta
26881 ggaggttccg aggatcgaat gtttcgtgac ggtcaatgta gaagtcgtca tagaggctga
26941 gatacttgag gacaacccgt tgttgcttct tggcggaata ccgctctact ttgccatgac
27001 cactaagata agtatagcca aggtagtttt tgggcagctt gaagaagatg ctacgggcag
27061 cctggagggg tactttggga ttcatcagat aggtttggat gagtttctta cgaatctcct
27121 ccgccttagc ttgggatagg gcatcattta ccagcaggtt acatgcgtaa tgagattcca
27181 tgtgtctctc ctttagatat aagagcaacc cccggcacca caaggttatt ataccacaga
27241 aagtaacttt tgtcaagccc ttttgtggaa aaccttgtcg taccagcgat agaagtattg
27301 ggcgaaggta atccccaggg caccacccca accgctcacg aagatgaacc atccgatatc
27361 caaatggctc gacccgactg ccttgatgta ggcaaactga gcgagggtga tacaccagga
27421 gactacaaag acagctttaa ttttgtcatc cctgagcagc ttagagttca accccaagag
27481 gaagacctga aagaatgcac tccagaagat gacaaggact tgtagggtta ctgacacgac
27541 tcacatacct cggggtccaa cccgcaggca ttacccagct cgaagtcatc agcatcgacc
27601 tctggaccac cccagccacc gctgaaggct gcctctagag ctgcttcctt gcgggcttca
27661 tcctggggcg taggcttgta cttattgtcc atcttctttc tcctctacgg aagtccatcc
27721 acggactgcg cctacttcta ggctgcggtt gagcaagggg ttagaatcag cctcgccttg
27781 gaagaatcga atgatctctc cttcgatccg atagaagtca gcatagaaca ctttggtgtc
27841 ctgaaactga acattgacca cgtacttctt catcctagat cctcaggggc ccgaaggccc
27901 cacctcattt actttttctt tcgaatgcct ttggccttac gattcccaac acgaccacca
27961 tcagcagcat tagaagagtg gctacggaca cggaggttag aatccccgtt accgccacca
28021 tctttaacac gtttgatgtg atcgaccacc tcgtcagacc cgagtttccg tccaagacgc
28081 ttttccacct tacggcgggc tcggtgccgc tgagcatctc ctgacttaga gccaacgccc
28141 gtttcaccgc gtcgtatagc cagttctctt tcacgcttgt aattcctcac acgtttagcc
28201 aagaaccagt cctccactct actagctcct cccaggtcat cccgagaacc ttaagcaggt
28261 agttgaagag tgccatacta acaactccat cctgtaggca atactcaaac atttcctcgg
28321 agaacttgga gaagtcgttg aaatcaccct tgtggcactt caggaatcga ccccaggctc
28381 ccagcgagtg tcccatagga cggtcaggcc aggtgagtcg ggaggcgacc aaggtatcgt
28441 aagaccgttc ttctggaatc acgataccat gaagtttctc aaggaccctg ttgtcgtagt
28501 ccaggatgtt gtgcccgact acgaactttg catgggcgat gatcctgtag aatgtctcca
28561 tttcctcagg ccggaatccc cggactacct gagttgggat atctacaagg acagcgcacc
28621 aaagccttgt gacgttatcg taaagggcat caccctctag gtcgtagata acgtaatcaa
28681 attggggact cgtcgtcctc gggtacttca tcatagctgc cttcacgctc cgttaggcaa
28741 cccgtttcag ggttgtactt ggtgaacact agcccggtgt taccgtagtt ccgatccttg
28801 atgacccgga tacggctctc gtgcttctct tctccagagg cttgcttgtt cctctcgaag
28861 ccaatcatca gttggcacca acgctgcatc gcacggctac cagtgaattg actttccttc
28921 acctcagccc cttcctcgtg ggtacggtta ccctttggcg ggttaaggtg ggagaagatg
28981 aatactcgga tacccaactc gtcagccatc ccggccaact ctgtgcagat acgagcaatc
29041 tcagtgttca tttcggaggg agacaagtgg ttagtcatgg cagtcatgtt gtcaagaatg
29101 acggtcttaa catccatagc gaccgcccaa tagcgaatac actccttgat atgatcccaa
29161 tcattctgac ccttgttctt ccacatgaag agcttgcccc gaagctggcc agcagcatcc
29221 ttgaacgcct ctacgtccca ctcaagatcg ggccggtgga atgccctttg ggctacctta
29281 cctgcgatgt tcttgagtgt catagcaact tgctcttcca gaaggaaggt tcctacgttt
29341 tccccatgtt cgatgatatt ccatgctgca atgtggtgag ccagcaaggt cttaccaatg
29401 ccagtaccac cacctacacc aacgatttca ccgtcgcgct gacccatagt tagattcgtc
29461 aggccttccc aggggtaact cttgccccac ttaggtggct caagggcttc tgcaaagacc
29521 tcatctacgg taacagcaca gtctggggat ttcaccttac tgccgaatcg aatgagctga
29581 tagacttcat ctgcccggtt gcgcataagc atgtcgttag catccttgag gggcatttcg
29641 acaaacttac agtcagggag gagggcacgg accctctcga cagacttgcg accttcctcg
29701 tcagcatcgt gacagtagac aacctcttgg aacctatcga gaatcccaga ttccttgagg
29761 aaaccaatgt ctcgaccagc agacccaact ccagaagacc agctaatgga tgcctgccgt
29821 aggtgtttcc acttctctgg taacttactt tccatgatct gagcaatcga catagccgaa
29881 agctcgtcct cagagataat aagcttaagg tgtcctacgt ccttgtgaaa gagcgtctca
29941 aggccgaacg gatcgacccc acccctgggg ctaccccgat agtaaaacgc cttaggatcc
30001 aatatccgga cgttatacgc acggtatttg ccatcctttg tccgtgggta gtagtgttcg
30061 atcacatcta caccattctc catggacaat cccacacgaa ccccatagcg ttctgcgatg
30121 gttttactga tcttgcggga gtcgagggcc ttgaaggggt attcttggac ctcagcgact
30181 tcccggagga tatcctcttc ggatttctcc gttcgcttag gtactacaaa gccctcgtcc
30241 agaacctcat agtggccaca acggttgcac ttaccgaagc ggctaccttt ttcttcgtcg
30301 atgaacaaga tgaggtgatt acctgtgtga tccccacctt tagctcggca acccggacaa
30361 gccgtatcac cgatgatttt cttcatttaa ccctccagtt gactcttgag gaccagggaa
30421 ggaaccgggt taacattacc cggataggtc agataggggt aggagaagtc acccaattgt
30481 ttctccagca ggcgcaactc atcttctacg gccttgagac gctcccacat gaagcgaata
30541 ccagcagact cgtcatagta cccgctgtaa tccgagtcat ccgtagcagg ctctacagac
30601 gcactgatgg agtcttgtag ttgtctctgg gatgccatca ggctgatgat ccgacggagg
30661 agctgacgtt tcccctcatc atcggttttc atcaggttgg ggatatcacg gtaaatcttg
30721 tgtgccttaa ctacatcagt atgggtcatg cagcattcct tttattaaca aatttacgcc
30781 agtcagcacc ctcgacgata tgcaggtctt gatcttcgtc ttggtggtag acaagggcgg
30841 taatcatttc cccgttgata cgaaagttct tggggctacg atcgtaccaa cccggataac
30901 cctcaaggcg atccaggttg tttaacattt ccttaccttc gtccccaccg gggagttccc
30961 acacttcacc cgtgacaaga tcctcacggt gtttgaagga caggatgggg aatcccccgc
31021 aggagtacat acggcctcgc tcttgggagg tggcatgccc gacgaatcgg gcgccctcca
31081 gaagacagtg gttgccgaag ccgtgcatca gtgttccata aacaaaaaca aacatcagat
31141 tacgccctct tcgtagattt tggtgaatgc ctgggtgtat gcctccaggg cgctaccccc
31201 ttcatccaga cccggagcag tgttgatctc cagaacgtag gcgcggtcag tctcgtgctt
31261 gtagacgata tctacagcac cgaagtccag gccacagaag ttgaccgctt ggattgctgc
31321 gcccactgcc tgagcatggc cctggcgttc ttcggcatca ttgacaccgt agacccagcc
31381 gccggctacg ttgcggacga tgctttggga gtcgtctgcc gtgttctcct cgacgttacg
31441 gcggagctta acctgggaca ggatagcccg gccacgcacc acgtggattc ggaactcggt
31501 acgacggcct acgatgccct gggtgaacag acgagcattg attacttcat cggggatatt
31561 cgtaacaccc atgacatata ccgggtactg cctgctgcgg atcaactgct ggatagcctg
31621 gatttctgca tcccgagtag acaccagcag ggagatcccc tggccactat ggccattgag
31681 ttgggtacga acgaagatac ggccaccacc attattaacc aaggcaacgg cgtcatcgaa
31741 gttgttagtc cagcgaggga tcaggtccgg gcctacagtt tgcatatggc ggaagaactc
31801 atacttcttg gtcaccatcg atacaacctg ggggttgtta aggaagatgg gggccaggcg
31861 acggagacgt tcagcctctt ggttctgagt accccagttg ataaccatgg agccctgacg
31921 gccacggtag gtagaaccct cggaacgaag aattcgtcca cccagggcat tgcgaagggc
31981 tacagcacca ttggatgcac ggttgccttt gtagatatag atcatagtgt atctcctgtt
32041 tcgttgaggt tagtgaagcc agcaatagcc cctgaggtcc taagttgaac cccatgtaca
32101 catcttagga accggcatag gtcggccagg ggctattact aacgcactac cttactcgaa
32161 gtagtactcg tggagcatat ccaccgcttc ggccaggacg atcggggcag gcaccaggaa
32221 ttcttccccc ggattagcct cattcagctc ctgctccttc agccgacgga tatccgccat
32281 cttatccaga gtctcttggg agaacggata cttgcgggtt gcgtcggttt ccatgtggat
32341 tactacttga cgtttgaatt gctgggtcat gtgacctcct tatactgctt cggaaagtcc
32401 ttcacggaca catttgccac agacgaactc acactcgtta agctcgccgg tgaacttgct
32461 accttcgtac accgtaagat cacggttccg ttggtcatag gctgtaggga tatccccgca
32521 gacagcgcaa ccacgacata caaagtcttg gaagacgtag ctgttcacga aggtatgccc
32581 ttggcacttc agtggatacg agatattcgc cggtggagta ttgccagcct cggacttcat
32641 ctgaagaact ttagaagggg atgtccgcgt tccaatgatc tgcaacgggg tcccatccac
32701 cggactggcc ttgtgctttg ggtcaaggca acttacggca acaccttcga ccacagcttt
32761 aaaatcgcgt ccttcaccga tgaagtaggc gttggagata cttccacgga gggtggtgta
32821 tccttcgagg gcttcgacgt tgagtccgta ggcttcgacg accattcctt catcgaggtc
32881 aatcccgacg actgtaccaa agccagggtc ggccttgtag ggttggactt cgacgattcg
32941 gaaggtgagg aggctgtgat gcttacggta gcttcctgcg gatcggagat tgttgttgat
33001 tcgcagggtg ttccttgcat acgcctcatc cgaagccgtt cttgacgacg aagctttttg
33061 gccagcttgc gttcccgctt ggctgccttt gcttccttga tcgtcatagt actccccgag
33121 gtattgcttc caggcgtctg ccccgacata gttcccccag aacttttctg cctgacgata
33181 actttctgga atcggtaggt cgagaaaggt gaccggagag ctgatgggct ctacaccctt
33241 ccgcacgccg gcctccgtga acgggatgga taccagagtt tcttcagcca gctccacgat
33301 gttaccgcga agcttgattt tgctggatgc acgctccagg aaggacttga gcatccaatc
33361 ctcggatgcc catacgatgg tcccagtggt agtaacagcg aagaacagag gtcgttcaga
33421 gttacgaacg aagttcaggc tgcgctcctt ggcatcccac cagaccaggg cagcagcacc
33481 cgagaagcgt tcctccaggg tgctacgaat cccatgcttg gcgatggtgg ctgcaaccat
33541 gtgggaatca accttgaggg tatcgttacc ctccagcaga tcgatacccc aggcatccac
33601 ggtgccattg tgaaccatcg tgatgtggtc cacttggaag gggtgagcat tctcatggtc
33661 ccctttgtca cccatggttg cgtaacggtt gtgtccgatg tagatgcggg cacggttttc
33721 cgtgagaaac ttcttggtat cctcgtgggc caggaagtcg taggcatcta cagccatctt
33781 gtggatactg acctcgttct tgatcggatc gaccttggcc aaacccgtgg catgagcacc
33841 acggacgata tcagccgcca ggaggttctt gagaagagcg atttcattat cactcgcgtt
33901 agttgtagaa cagaagccta ctaatccgca cataggtatt actccttagt aaagttcttg
33961 gtgaatgtta acgccgtagg tacggaggac gtaattggta tggtccgtca tcagcataac
34021 gaaagcttgt acaacctgag ccgctacccc ctcgtcagtg agatcgaaga cgttacggac
34081 ggttgcatcc tgataaccca taccacgcag ggcggtcacg gtcatcaagg cattacccag
34141 gttagatacc tcccctggag tccttgcgat gttgaaccga ttgacaccct cctcagagaa
34201 gctcaaagga gttgtcgctg ccgcagtgag ttctgcacga cggcggttct gttcagcacg
34261 ctcttgttca cggatgcgcc gctgacgatc ctgctcttcc tccatcgggt caacaccatt
34321 ggcgatctga atacccgtgc tgatagccaa ggcagcagcc gccagaccca tctcacggcc
34381 acccggagac atgttgtagt ccggggagag ccccaggtgg aacacatccc gcagatccac
34441 attggccagt acctccagaa actcagaggt gtcaacccct tcgtgaccct gggcgaaggc
34501 cttgaggcag agcatacgct gcatcagccc gaccatttca tcccgagagg tcatcgcatg
34561 ggagccccgg aactcgatgg acccgaaggt cgtaacggtc tggaggttca gggcggagta
34621 cttgggccag ttcatcaggc ctcgaatccg aagaccgtct tcattgacag ccaggagacg
34681 acgaccgaag gtttgagaca gccaatcgtt ggagaagaag gggatacaga agttgctatc
34741 ccggcggtag ggttcacagt ggtcgaagaa cacatcctcg aacaccatgt aggtcaggac
34801 ggtcttgatg agaacatcca tcgatgagtc ccgcatgtcc atgtgaaggt gggtggagca
34861 gcggaaggtg ggtgccggct tgacagcttc catggtggca gcgaaacggt ctacccgttg
34921 gattgcctct gcaccactcg aagggccatc gaagatgtac tccataccac tgcggaggga
34981 accatcttcc ttgcggttcc acccatcgat acggggccat tcattggaac cctccagttc
35041 aacctcgaac ccgaaggacg cgattgctgg gagttcctca tgggcttgga tctcaggaag
35101 atccctcttg cggtggccaa tcagagagta tagagccgac atagcagtcc ctcctgtttc
35161 ttgaattcat cattgacaac cagttggcct tccaccagat tacctaccaa catacccttc
35221 cagaagactc gcttgccttc ctcggtgtag aagtcccgat gggatgggct ggagatcatg
35281 tctcgggatt gcaggaagat ccggaggata tgcaccggat acaggctgcc attgctgcca
35341 atcccgttca ggatgaagtt ccgggggtcc agacctttct tctgagagcg gttgttgaca
35401 gcgaaggtga cgtaaacatt acggaagccc gtcccgtgaa tgtcatagta cccgctggcc
35461 ggtctgtcgg tcactacatc actgaagcga acccgagaat atcggccctc gttgtcatcc
35521 agggtgtagg tacgtcccag gagaacgaac ccatcgaacc gggtatcgtc gccatcttcc
35581 tcggtgccct cgacgtacat cacatgggga acaccatcct tctcgaagaa gacataggtg
35641 tttccgtagt acatggtgaa gtcgccggcc agcggatgat cgttgttcag gtcattcatg
35701 agccaccccc agcttctcca gggccgccag agctgccact gcgtcgttct cgttgatgat
35761 acgttgtacc tcggctgcac cgcctacggc tgcgatggcg tcatccaggc cgccttcgac
35821 taccacggag taagccttga gggccgagtc gtatgcccac ttaatcaact catcggagaa
35881 gatccagaag ttggacaagg tacgatactc gacaccatag ggcttgtagc ggcaggcacc
35941 ggccttaccg tagagcagct tacggtcggt gtcgccgtcg atcagcaccg aggccaggcc
36001 caggtagata tcgcaggctt ggatcaccgc acggcagttg gccttggtaa caggcaggtc
36061 gtcagcgaag ccgatgtgga tgtgaccgcc agcggtacga agggtcgggg gtgcatcggt
36121 cggcatacgg ttacggctgc gggtccaggc gttgtagtcc ggctcacaac cgaagacgaa
36181 tgctgcatca ccgaagccac ggagaacatc ttcctcgtag aggtgggagg acaggttgtc
36241 gatgacttcc aggccgaagg ggcgaatggt gtcgcgtccg atgttcagga cgctggtgat
36301 gccgtggtgg aattgctcga aggagctggc cggatgaatg ttgtactcca gcagaacgtt
36361 atcctcctgc aacgccccac cttccaccgg gatgggctcg tctttagtac caccgacgaa
36421 gccgatggca gatgcgggtt cacgaccgaa gcctacgaag acttccgggt cagcaccaat
36481 cagagggata tttttcatgg cagttctcct atttaatcag ttggttttcg gtgaagaatt
36541 gaatgagggt gtcctcgtaa ctatcgagag gcattacctc atattgctca cggttcttgt
36601 cgttgaggtc gtaagtgata cctgcggaca cgctgatgat atcatcatcc tcgtacccat
36661 ccaggccgag ttcctcgata gctcggcagt ctttggtata cccctgccag agagggtcct
36721 tgtggccgct gtagagacgc ttgaaggttt cctgagtacg acccatgata tcttggatat
36781 cgtacagggt gggcccgtgg agaagctctg gggcttgtac ataatcaccc cagctatcaa
36841 tccgcccaag gcccaaagcc ttggccatcg tctccgtcag gtaggagtca tctacctcta
36901 tgccctcctt ctcgcattgc tcacgatact ggccagcagt cacggggatc atgctgacgt
36961 agctgtcgca atagaagttg tggccaatcc ttgcgcaggc cacgaggaca gcaaccacgg
37021 ggtccagttt ctgtagcagg ttcggctgat ggctgctgtg gaccagcatg tgggccatcc
37081 gcagggcatt gatgatgggg cctccggttt tgtccatatc tacccggaca tagaaacggc
37141 tcatcgcccg tgggagttcg aagtccccga tgggcttgag atcaccattg ccatcccacc
37201 actccttggg gagatcctcg gacgccgcca ggatagcacc atcggtcatc ctgttgacga
37261 aatcactgtt gaggaagtcc acagcgatcc ttcgggtcac ttcgttgtca gcatgggaaa
37321 tgaagtggac aacgcagccc gcttcaccat tcctgtcctc gaagtccccg tagcaacggg
37381 tatgaccatt gaggttctta acttgggaga agggtcttcc ctcccggtcg attacttctg
37441 ccgcatacat tcccatgatt aatctcccat gagtttcttg aggtgttgac agattgcatc
37501 cagactgggg aggaaggact cttttcgtgc cccattcatc ggacgagaca ggtgaggggg
37561 tatcaactcg atacgctccc ccgcgttctt cacggagggt acgtgctgag gaagcagctt
37621 gttgctctgg aagaagggcc agtggctatc ctcccatttc cccaggtagc agggctgagg
37681 gtagatggtg atctggaact ccttgtccat cgtcttccgc ataccctcga tcttctcctt
37741 attgaaacca tagtaagtag gagtaacccc caggatgaag tcccaggtgc catcctcctg
37801 cttcaaccac cggccatagg ttccttggtc ttcgaccttg ggcatttccc agtcgccctt
37861 gaggagtctt tcgacggcct cgggcttcca caccttgccg tggacgtttc tcagggggtg
37921 ctcggtgtac ccattggcca tcaggttgta gcaggacatt gccacgtagg ataggaggaa
37981 tccgtgctta tcggccaact ccagatgggc ctcttcctcc caatcgaacg caccagagga
38041 tacccacttg aagaggagtt tgaccacggg ataccagacc tccggggtag tggtccgggg
38101 gttcatgtag ataccgcaca cgtaatcgtt accccacatg cggtcatcgg tgaatacctt
38161 ctggttgggg aatcgattcc agggtgcgct cttggccttg gaccccatgc gccagtggtg
38221 gatcttgggg acttttacct tggtgttggc caccgtcagg gtaatgtcag cgaacatctt
38281 gttcatctgg cggatgtact tgggggtacg gcgagcttgg atgtagaacc aaccgttcca
38341 gttcgagaag tacttagcct ccagagcgcc aaagcaggag ctattggtca tcatgacgag
38401 ggagttcccg tggttcattg cgtacttgag tcgagccatc ttgtttctcc ttggttgagt
38461 tagccagcaa tatccccagg gagttcctag ggatattact aacgccctct tagaaggggc
38521 cgcgacgctg ctgcttaccc ttgtggggcg caggaacctt ggtggccttg tagatgccgc
38581 cattcagggt cagctcgccg gaggttttca gtcgctcgta gaagactttg gctttcatag
38641 gctgtatcct tgctggtgat gaggggagta aggaaggcca tgcacaggct gatgaagagg
38701 actaccatca ggaggtagta aacccaatca tcatccggtg gcctcttggg ggatccagag
38761 attgctggga tattgtagat agcgtcatat atgtccgaag ttacctcact ggtacggtaa
38821 caccggcggt gcccttgggt gcggtcccca ttgctgttcg tcatagtaca tcagacctcc
38881 accgtgaagg tatggccctt gggaagtaat tcgaagatat actctacccg ccctggttga
38941 atgtcccaac tgttgccagt ctccaggcat acgaagggaa gcgtctcggt gtcaaggttc
39001 agtctgcctg acacgaagat tcgaccaccc cctcggtgac gccagaagtg ggggactact
39061 tcttgggttg tacgaacctt tacttcattt ttcagtcctg ccaattcatc acgaagttcc
39121 tggatctcca tctccattcc gccgcactga tggcgagcat catcgccctt cgctgctgcg
39181 tcgagcgcca tcgccaatga cttctccaat tcctggatct tggccgtggc tacttccaga
39241 cgcttagcgt actcgtcgcg gtcatacata acctgcatga acttctcgaa actgacgatg
39301 ggtttctccg actcactcat catccacccc caaagtcttg acctttttct ccagtcgctt
39361 actgtagttg tacaggtact tcaagaagaa gagcccatag aagatggatg caaccatcag
39421 accggcaccc agggcgctag ccgaggttga atccgaggtc atcaggtagg ggaggatcag
39481 aaggtagaga atccacagag ggatagccac caacatagtc cgggtataga gcttgagcat
39541 ttgatacctc acataataag taagatataa aggtagacct taaggtatcc tataggtata
39601 agagcaaccc ccggcacctt aaggttatta taccacacat ccagcagaaa gtcaataggt
39661 caaatgttac aaacctttaa ccaacttgct gatgaagtcc tcgctcggga tggatccgtg
39721 gtcccagtcg tagcggacca ggttctcccg gcacagcttg ccccaggtgt cacggacccg
39781 gatgatgtgg actcgcacga gggtgtcgtg gttgtcgctg ctggcccaag ggttgctggt
39841 gctccccagg cgactgagga tacggtcggc gacccgctgc tcattgttca gggagaagac
39901 catgagggcc tcaccttcgt ggtactgatc ggccagggcc tggataacat ccattgcaaa
39961 cttcttgggg ctgaacccct cggagtcctt gatcgattgg tagtcagcgg tactcgtagg
40021 acccatgccg gtgtagattt tggcggtgca gcacgagggg aagttatgct ctctcatttg
40081 atggctcctt tgataatttt gtagaaggat atgatgaaga gtttcatcgg gaagatgagg
40141 taataggtca tcaacccgaa gaggatcagt gggagtgata ggggccacaa cccgccaatg
40201 acgatggcgt gctcttcctt gatccttccg ctatcctcga atagggccaa ggtcacgcac
40261 actcctacgg cggccacgag gaagtagatg aagaggcaca tcatgaggaa gaaggccgcc
40321 gctgcataga cgattacgct ttccattaga acctcctgta gtggccgctg aagagccgct
40381 tggctgatat gaagacttcc ttgaggggcc tgtagcaggc gaagtacagg atcatccccg
40441 gcagggacaa gggccagaag aaggacagga gaactgccca atcacgatct gacccccacc
40501 tcatcccgca ctcttccaat accgcataga tcaggcagga tgtgaacccg tagaccgcca
40561 acccgaagaa gatagtggcg gagatcatga ggatttcttg gatggtcatc accaatccct
40621 cgcgcagttg cagcaacgac cctctttggg accgaagact ggcatacagt gggggcaatc
40681 ctccccggat tggatcatag cctccctggc gtgccgcagg taagccgatc ggctcgactc
40741 cacacctacg gctgccaagg tgaagccaat ctcaccacgg ggctcctggg ggccttcctg
40801 acgggtcatg ttgaaccctc gtttctctac tcgacgcttc attcgccgct cctgggccat
40861 gatttggccg atcattggtt tactcttcat acggccccca catcctggct gacacgtgga
40921 cttccttcgc tgggtagagt tcaccatggt tgtataccac attggctgcg aagatggaga
40981 aaccaacctt ggtgataatc gtcacggtcc cgccttgttt gaggtagacc gaatctcccg
41041 tgaggcttac atacacacca tctttacgct tactgatgtg caagtcgcta cgtggctggg
41101 atactgctac ggtgaaagta gtcatgggtc acctcagtgg acccgatgaa ccttgtggtc
41161 caccgggatg ccgagctcgt aaagggtttc ggtgatgaac tggccgaagt tgatgacctt
41221 caggtggaat tcaccatcgg ggctagccag ccagtaaacc tggggttcag tggatttcat
41281 agacgatacc tgcacgtttg ccgaagatcg acacacggat gtgagtaaca gaccagttgg
41341 ggtacagctt ggggttaggc tggtatcgcc ggatgacaac cttggatacc aaccagtggt
41401 agatgtattg ggcgggcgtc atagtacaca ccctaggccg gaggtccgaa ccgatggact
41461 tcgatggacg cagccttgat ggtcacgggg tagaacccgc agtcaacatc gccgctgaag
41521 tatacggcac ccacgggtcc accgaagata tccacgatga agaattcatc tgcaacttcc
41581 atgtacataa agacacgcgg gtttgcagct ccgtcctcgt cctggcggat gtacagacgc
41641 cccgactcca gatcatccca agaggcaacc cggatcttac tggttagcat attgtaattg
41701 agtttcatgt tacacctcct cgattgggat gaccatgagg tcgccgaaca tatctttgac
41761 cctgttggac gagtccttca cggccacctc ataattgtta atcatggcct tcgccgaaga
41821 tagggtcggg gttttgcacc agggagtacc cccttggtag atgtagcaaa cattctggta
41881 aacaaaaacc atatgcctac caatcaccac tttcttttta aaaaccccca ctgacccgtt
41941 actacaaccc ttagtcacga tcaccttaca cccccttgag gacgtaggca tcaaaggaat
42001 cctccctatc ctcggggatt ccttcgagtt cgaaagttac atagcgacca tactccgccc
42061 gaaggtaatc aaggaactcg tccttgacag cctctgggtc ggtagcgccg cctagggaag
42121 ccatgttgta gagggacgac aagtggtatc gccacgggac gtatacggtt ccatcctcaa
42181 ggacagatac cttatccttt ggcaggccca tcatggtgtt ttaaccagac gcaggcagct
42241 aaggcctcgg taggtgccat aacaaacagc cccttcctcc aggtcgtaga gcctgtagat
42301 actcaccccg tccatcttgc caaccacttc acccctgctt acatccacgg gtgcattttt
42361 gcgaaccacc gtggtcgcac caatcaccca accgatagcc agtcccgaca ggatgatggc
42421 tgcgaatgag aaaccgttca tggctacacc tcgtagcaat tcagctcggc agttactggg
42481 tataccagac tcaccggagg catgtaaatg acgttgccag tcttgagatt gagaacggga
42541 acctcgtcgg attcgccctt catcttaatg ctgcggagtt cgcagaccat gtacacatcc
42601 ccactgatga ggaatgtttg ggacttaacc agagaactga gggttactcc gttgcggggc
42661 cacaccttga tatccattgg gctacctcac gatgcaaaag ggatgctgtc caaggtcgag
42721 gacaggacga agagaaccac ccacactacc agcaacaacc cattggaacg tgagcgtatg
42781 gcggcacatg caatatactt ccatgccatc accgcgccct gttcttaacc aaagatgccc
42841 gcttggcacg gagcttgttc aactccaggg ttttaccaac gtggtttcct ccggagttag
42901 tcaactcacg gacagccttg gcaatcttgc ggtcgatagc ctcgatggct tgcatgttgc
42961 ggctaacctt acgatagtcg ttgcgtttca cgggatagtt tcctttgttg atttcccaag
43021 actccccagc ctgcgaccat aggtccggtg ggggtttcgg ccaggaatca ccatggcctc
43081 atcagttggg attagatacc catttcctct ttccaatcac gaaagaagaa gtaggcgata
43141 ccgatgctgg atacaatgat agcgatggtc atttgctaag tttccttatg agttcctggc
43201 gctcaacaat ccaccgggga tcgggatgca cccggatcat cctagtgagt ttcttgagac
43261 ggttaatcat ttgggcacgt tcatgggccg cttcgtaagg tgacttcatt tgatccaccc
43321 gcagatgttc agacggatac cttccagagt gtaaacaccg caggcaaatt taccgtcctt
43381 gaatgtccag cggtacacga taccagcgtc gaaacctacc cttgcatcgc agaaaccaga
43441 aacataatcc tggccttgga tggtatggac ctgcccaaag atacagtaac ccacggaaac
43501 ctcctgatgg tctatcgcta caatgcacgg acctaccatg cactctaggg atagacctgg
43561 ggcgcgtcat agtacacacc ccaggcgcac ccggcgttac gctgccttcg cttcgtcctt
43621 gacttccagt cgttggatga tggcgatacg ctcgtccgct gcctggagct ggcccttgtc
43681 gatggcgcgt tgaaccttgg ccttgaaggc ggcgatggct tggtccaggg agaactcgtc
43741 ggccacgtca cgctctttct tgtacttgaa ccagggtttt tcggctgcac gctccagtcg
43801 agtggccttg tccttggcga agacgaacgg gaattccttg gccttttcct tgtcggtatt
43861 ggcctcgatc ttgccgttgt ctacgaacca gtgggccagg gccagccggc gggagccttg
43921 cggcatcgcg ttgaacagct tgcatgccaa ggacacctcg ccatgctcgt cgatatgctt
43981 gaggatatcc atgccggtgg tttgaaccag cttgtccagg gcagcacccc ggttggcaat
44041 ggtcttgatg atcccattga tacgcttgta gtcgctcatt gtatttacct cagttgttta
44101 cttcgacagt gatgacggca gagttaccac acttgccagg cttataccag ttccgaaggt
44161 tagtaacctc acggttacgc caatcggtac tcataagagc cttgcgttta cgcgcacctg
44221 ccttttcttg caacgaagtg gtcttgtcgt cgaggatctt gttacaactt gcaataatcc
44281 caaacttctg ctcactacgc tgttgggcct tccccagatt cccaaggttg taacccaaag
44341 ccttggcctt gcggttggcc ttgcgacgca gctttttgtc aagagcctga gtcatggtcg
44401 tttcatcctt taggaatcat cagccgggac acacatcccg atacgacaaa ggggtttatc
44461 ggcaaacctt ggcattggcg tagccggccc ctttccgcgt tagtatcgct gttatggtct
44521 gtcctctggc tatcctcggg agtcttcgtg tctactcgtc cctaccttcg ccagtatcta
44581 ccaagcttcg ccctctgcgc taagccattg atactaaccc aacatactcc ccgtcgcgct
44641 tgaaccacgg ggtctgtcaa ttgattgcgc tgggacaggc taccagtcgg gccttctatg
44701 gtacaaggcc aggacctacg ctctttcgga gtgtgcgtta ttccctcagc tttcgggttt
44761 ctcccttgtt cagtccaagg accgtcgaag gtacactttc cccaggtggc cgtcacctga
44821 tgggtgccca tgttagaggc ttggacttgc cttgtcaagg ctacgctaat cccgagggag
44881 tcatgcacgt tatgccgttg actacggggc gaactatacc gcttcaccga tcccttgtca
44941 acccctgatg cctgccggtc ttatacctgg gtgacttggg cgctcttccc tggttggcag
45001 cccccggata gcactgcggc aagggggatg gtggcctagg tagaacgtgg ggccattaga
45061 cccggttccg cggggtttgt caagcccctc ggggtttccc ccggtgcctg tcggtttccc
45121 tcaaggcggc gccattacgc catattcttt acggggttgt ctactggttt ttcatacagt
45181 ctatggacta tcagtccccc agcaaacccc cggatataga cagtctttga ctaacatagg
45241 ggatcaatgg aagtcaatag gggatcaagg ggttatcaag ggatattccc cccgatccac
45301 cccctgaata ccctaagatt tttcttatga ataccctagg gtccacccga tgaacggtat
45361 ccctaggggt tgacccccgg actagcctta tggtatcctg gggagggcct aggggctagt
45421 acccctggga gagggccacc ccaacgttag cctgggggac tctgggggg
//